KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592425Help
Entry
592425            CDS       T01019                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    592425
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    592425
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    592425
Enzymes [BR:spu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     592425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 485 aa AA seqDB search
KFITPGSVRVGSSSDRERLVEHLAFKLPDGDMALVVLNRKEFTFPLHIYDPDVGYLNAEI
PSLPDTSITITVDRNEEYQTILGFGGSFSDSAALNLYNLSSDTQDKLLRAYFSSDGIEYS
FGRVPIASCDFSTREYSYAETPDDFNLDDFQLAFEDIDYKIPMIQRASAMSSRPIKLLGS
AWSAPGWMKTNGAMKGGGALRGLPGGYYYKTWALYLAKFLEAYSAYDVDFWGLTTGNEPT
AGLFPGWDWQCMFFNPELQRDFIKLDMGPILHDRGHKDVEIVIMDDQRFHLPHWAEVVIE
DPVASQFVSGIGLHWYTDFLIDASRLNETHHAYPDYFMINTEACEGYLPWQEKVILGSWE
RGESYSHDIIEDLSNWVGGWIDWNMALDMIGGPNWVGNFVDSPIIVNAEEDVFYKQPMYY
HLGHFSKFIAPGSVRVGSSSDRDRLVEHLAFKLPDGDMALVVLNRKEFTFPLHIYDPDVG
YLNAE
NT seq 1456 nt NT seq  +upstreamnt  +downstreamnt
taagttcatcacacctggatcagtgagggtggggtcatctagtgatcgtgagaggttggt
tgagcatctagcattcaagctcccggatggtgacatggcacttgtcgtcttaaacaggaa
agagttcacgttccctctgcacatctatgacccggatgtcggttacctgaacgctgagat
tccatctctcccagatacaagtatcaccatcacagttgatcgaaatgaagagtatcagac
catccttggttttggcgggtctttctcggactcagcagctctcaatctctacaacctatc
gtctgatacacaggacaaactgctgagggcgtacttctcatccgatggaattgaatactc
atttggtcgtgtaccgatcgcgagctgcgatttttcaacaagggaatactcgtatgccga
aacaccggatgacttcaatcttgatgatttccaactcgcctttgaagacattgattacaa
gatcccgatgatacagcgagcctcagccatgagttctagacccatcaagttgttaggcag
tgcctggtctgccccagggtggatgaagacaaacggtgccatgaaaggaggtggtgcact
cagagggctgcctggagggtactattacaaaacatgggctctctaccttgccaaattcct
cgaagcctacagtgcctatgatgtggacttctggggtctaacaacaggcaacgaacctac
ggcaggtctcttcccaggttgggactggcagtgcatgttcttcaatcctgaactacagag
ggacttcatcaagctcgacatgggtcctatcttacacgacagaggccataaagacgtcga
gatcgtcatcatggatgatcaaaggttccatcttcctcactgggctgaagtggtcatcga
agacccggtggcctctcaattcgtttctggtatcggcctccactggtacacggacttcct
catagatgccagtcgtctcaacgaaacacaccacgcttatccagactacttcatgatcaa
tacagaggcgtgtgaggggtacttgccgtggcaggagaaagtgattcttggtagctggga
gagaggtgaatcctacagccatgatatcattgaggacctgagtaactgggtcggtggatg
gatcgattggaacatggctctagacatgatcggaggaccgaactgggtggggaacttcgt
tgatagtcctatcattgtcaacgctgaagaagacgtgttctacaagcaaccgatgtacta
ccaccttggacacttcagtaagttcatcgcccctggatcggtgagggtggggtcatctag
tgatcgtgacaggttggttgagcatctagcattcaagctcccggatggtgacatggcact
tgtcgtcttaaacaggaaggagtttacgttccctcttcacatctatgacccggatgtcgg
ttacctgaatgccgag

DBGET integrated database retrieval system