KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592425Help
Entry
592425            CDS       T01019                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:spu00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:spu00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:spu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 485 aa AA seqDB search
KFITPGSVRVGSSSDRERLVEHLAFKLPDGDMALVVLNRKEFTFPLHIYDPDVGYLNAEI
PSLPDTSITITVDRNEEYQTILGFGGSFSDSAALNLYNLSSDTQDKLLRAYFSSDGIEYS
FGRVPIASCDFSTREYSYAETPDDFNLDDFQLAFEDIDYKIPMIQRASAMSSRPIKLLGS
AWSAPGWMKTNGAMKGGGALRGLPGGYYYKTWALYLAKFLEAYSAYDVDFWGLTTGNEPT
AGLFPGWDWQCMFFNPELQRDFIKLDMGPILHDRGHKDVEIVIMDDQRFHLPHWAEVVIE
DPVASQFVSGIGLHWYTDFLIDASRLNETHHAYPDYFMINTEACEGYLPWQEKVILGSWE
RGESYSHDIIEDLSNWVGGWIDWNMALDMIGGPNWVGNFVDSPIIVNAEEDVFYKQPMYY
HLGHFSKFIAPGSVRVGSSSDRDRLVEHLAFKLPDGDMALVVLNRKEFTFPLHIYDPDVG
YLNAE
NT seq 1456 nt NT seq  +upstreamnt  +downstreamnt
taagttcatcacacctggatcagtgagggtggggtcatctagtgatcgtgagaggttggt
tgagcatctagcattcaagctcccggatggtgacatggcacttgtcgtcttaaacaggaa
agagttcacgttccctctgcacatctatgacccggatgtcggttacctgaacgctgagat
tccatctctcccagatacaagtatcaccatcacagttgatcgaaatgaagagtatcagac
catccttggttttggcgggtctttctcggactcagcagctctcaatctctacaacctatc
gtctgatacacaggacaaactgctgagggcgtacttctcatccgatggaattgaatactc
atttggtcgtgtaccgatcgcgagctgcgatttttcaacaagggaatactcgtatgccga
aacaccggatgacttcaatcttgatgatttccaactcgcctttgaagacattgattacaa
gatcccgatgatacagcgagcctcagccatgagttctagacccatcaagttgttaggcag
tgcctggtctgccccagggtggatgaagacaaacggtgccatgaaaggaggtggtgcact
cagagggctgcctggagggtactattacaaaacatgggctctctaccttgccaaattcct
cgaagcctacagtgcctatgatgtggacttctggggtctaacaacaggcaacgaacctac
ggcaggtctcttcccaggttgggactggcagtgcatgttcttcaatcctgaactacagag
ggacttcatcaagctcgacatgggtcctatcttacacgacagaggccataaagacgtcga
gatcgtcatcatggatgatcaaaggttccatcttcctcactgggctgaagtggtcatcga
agacccggtggcctctcaattcgtttctggtatcggcctccactggtacacggacttcct
catagatgccagtcgtctcaacgaaacacaccacgcttatccagactacttcatgatcaa
tacagaggcgtgtgaggggtacttgccgtggcaggagaaagtgattcttggtagctggga
gagaggtgaatcctacagccatgatatcattgaggacctgagtaactgggtcggtggatg
gatcgattggaacatggctctagacatgatcggaggaccgaactgggtggggaacttcgt
tgatagtcctatcattgtcaacgctgaagaagacgtgttctacaagcaaccgatgtacta
ccaccttggacacttcagtaagttcatcgcccctggatcggtgagggtggggtcatctag
tgatcgtgacaggttggttgagcatctagcattcaagctcccggatggtgacatggcact
tgtcgtcttaaacaggaaggagtttacgttccctcttcacatctatgacccggatgtcgg
ttacctgaatgccgag

DBGET integrated database retrieval system