KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592517Help
Entry
592517            CDS       T01019                                 

Definition
uncharacterized LOC592517
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 232 aa AA seqDB search
MASTSNPSLLPQKNIKQEIIVVFEPPAREMASSSSHSSVPQPETSQEINVVPVSPVKDMP
STSNPSSGHETGQENDMVPDSTGIELSKDDLKAGGGKVGSSSKKKSGCEKDSDEYKRRRE
RNNEAVRKSRQKSRQKASETEVRVTELKKENADLEQRVTLLHKELELLKDLFLTHANELP
DPSTTFGLFNANPRLGSSSPNPALSRRIVLKTESLTVSLTCRNVPESITTTT
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcatccacaagcaacccctctttgttgcctcaaaagaacatcaagcaagagattatt
gtagtcttcgaacccccggccagagaaatggcatcctcgagtagccactcctcggtgcct
caacctgagacaagccaagagattaatgtggtccctgtatccccagttaaagatatgcca
tcgacaagcaacccctcatccggacacgagactggccaagagaatgacatggtcccagac
tctacaggcatcgaactgtccaaggatgatctcaaggctggcggcgggaaggtaggaagc
agctccaagaagaagagtgggtgtgagaaggacagcgatgagtacaagcggcgtagggag
cgcaataatgaagctgtgcggaagagtcgccagaagagccggcagaaggcctccgagacg
gaggtacgggtgacagagctgaagaaggagaacgcagacctggagcagagggtcacgctg
ctccacaaggagctggaactgcttaaggacctgttcctgactcatgctaatgagctccca
gatcctagcaccacttttgggctgttcaatgccaacccaaggttggggtccagttctcct
aacccagctctgtcgcggcgcattgtcctcaaaactgaatctctcactgtgtccttgacc
tgtaggaatgtcccagagagtatcactactacaacatga

DBGET integrated database retrieval system