KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592598Help
Entry
592598            CDS       T01019                                 

Definition
(RefSeq) dual specificity protein kinase CLK2
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     592598
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   592598
Spliceosome [BR:spu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    592598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 479 aa AA seqDB search
MPRSRYQSPSRYSSRHRQRRKQRTPSYVRDRDGDDGDFYAKDYGACRYRSRSREYYREPS
PSPQSRHCRDYDRDRGRGNYYDNHFRDDFRHESSHRKRHSRRYRRPRRRSDSYSTSRHRE
EGHRASVIDDDEGHLIYRPGDCLQARYAITSTLGEGTFGKVVQCRDNMSGGAKIALKIIK
NIEKYREAAKLEINVLEKINEKEGVGKSLCVKMYDWFDYHGHVCISFEILGLSIFDFLKD
NNYQPYPLDQIKRMSHQLCSAVKFLHDMKITHTDLKPENILFVDSRSSIKYDPVKKRDVR
QVVNCDIRLIDFGSATFDHEHHSTIVSTRHYRALEVILELGWSQPCDVWSIGCIIFELYT
GFTLFQTHDNREHLAMAERILGNFPSWMIKRTRKSKYFYHDRVDWNQDNSSGRYVCENCH
PFRYYLDSNADEHRLLFDTIEEMLEFDPFKRATLSQVLDHPYFADIHYRGNRDMHSISR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgttcaaggtaccagtcaccaagtaggtactccagtcgccatcgtcaaaggagg
aaacaaaggactccatcttatgtcagagatagggacggagatgacggggatttctatgcc
aaagattacggggcttgcagatatcgctctaggagccgagaatactaccgagaaccttca
ccatcaccccaaagccggcactgcagagactacgaccgtgacagggggcgaggtaactac
tacgataatcacttcagagatgacttcaggcacgaaagctcgcacagaaaacgccacagt
aggagataccgaaggcctcggagacgctcagatagctattcaacgagtcggcatagggag
gaggggcacagagcaagcgttatagatgacgatgagggtcatttgatctatcgaccaggc
gactgcttgcaagcaagatatgcaattacctccaccttaggggagggtacttttggaaag
gttgtccagtgcagggataacatgtctgggggtgctaaaatagcactaaaaatcatcaag
aacattgagaagtacagggaagctgctaaactggaaattaatgtgttggagaaaatcaac
gagaaggagggagttggaaaaagcttgtgtgtgaagatgtatgactggtttgattatcat
ggacatgtctgcatatcctttgagattcttggtctcagcatatttgacttcctgaaagac
aacaactaccagccttatcctttagatcaaattaagcgcatgtcccaccaactatgctca
gctgtcaaatttctgcatgatatgaagataactcacacagatctcaaaccagagaacatc
ctctttgtggattctcgctcctccatcaaatatgatccagtcaagaagcgagacgtgagg
caagtagtgaattgtgacatcaggctgattgactttgggtcagcaacgtttgaccatgaa
catcacagcactatcgtttcaacgaggcattacagggcactggaggtcatcctagagctt
ggttggagtcagccatgcgatgtatggagtattgggtgcatcatatttgagctgtatact
ggatttacactgtttcagactcatgataacagggaacatcttgccatggccgagcgaata
ctgggtaactttccttcatggatgatcaagagaacaagaaagagcaagtacttctaccat
gaccgtgtggactggaatcaggacaactcatctggtcgctatgtctgtgagaactgccac
ccgtttcgctactaccttgacagcaatgctgatgagcaccgccttctctttgataccatt
gaggagatgttagagtttgatcccttcaagcgggccacattgagtcaggtcctggatcac
ccttactttgctgatattcactatcgagggaatagagacatgcatagtatcagcaggtga

DBGET integrated database retrieval system