KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592598Help
Entry
592598            CDS       T01019                                 

Definition
dual specificity protein kinase CLK2-like
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 526 aa AA seqDB search
MADVCSHSFVLAVNYLSTHESCWDISPQSLRLGRDVPWGELARIQFMMPRSRYQSPSRYS
SRHRQRRKQRTPSYVRDRDGDDGDFYAKDYGACRYRSRSREYYREPSPSPQSRHCRDYDR
DRGRGNYYDNHFRDDFRHESSHRKRHSRRYRRPRRRSDSYSTSRHREEGHRASVIDDDEG
HLIYRPGDCLQARYAITSTLGEGTFGKVVQCRDNMSGGAKIALKIIKNIEKYREAAKLEI
NVLEKINEKEGVGKSLCVKMYDWFDYHGHVCISFEILGLSIFDFLKDNNYQPYPLDQIKR
MSHQLCSAVKFLHDMKITHTDLKPENILFVDSRSSIKYDPVKKRDVRQVVNCDIRLIDFG
SATFDHEHHSTIVSTRHYRALEVILELGWSQPCDVWSIGCIIFELYTGFTLFQTHDNREH
LAMAERILGNFPSWMIKRTRKSKYFYHDRVDWNQDNSSGRYVCENCHPFRYYLDSNADEH
RLLFDTIEEMLEFDPFKRATLSQVLDHPYFADIHYRGNRDMHSISR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtttgttcacattcttttgtcctggccgtaaattatctctcaacccatgaa
tcatgttgggacatctcgccccagtctttgaggctggggcgagatgtcccgtggggcgag
ttagcccggattcaattcatgatgcctcgttcaaggtaccagtcaccaagtaggtactcc
agtcgccatcgtcaaaggaggaaacaaaggactccatcttatgtcagagatagggacgga
gatgacggggatttctatgccaaagattacggggcttgcagatatcgctctaggagccga
gaatactaccgagaaccttcaccatcaccccaaagccggcactgcagagactacgaccgt
gacagggggcgaggtaactactacgataatcacttcagagatgacttcaggcacgaaagc
tcgcacagaaaacgccacagtaggagataccgaaggcctcggagacgctcagatagctat
tcaacgagtcggcatagggaggaggggcacagagcaagcgttatagatgacgatgagggt
catttgatctatcgaccaggcgactgcttgcaagcaagatatgcaattacctccacctta
ggggagggtacttttggaaaggttgtccagtgcagggataacatgtctgggggtgctaaa
atagcactaaaaatcatcaagaacattgagaagtacagggaagctgctaaactggaaatt
aatgtgttggagaaaatcaacgagaaggagggagttggaaaaagcttgtgtgtgaagatg
tatgactggtttgattatcatggacatgtctgcatatcctttgagattcttggtctcagc
atatttgacttcctgaaagacaacaactaccagccttatcctttagatcaaattaagcgc
atgtcccaccaactatgctcagctgtcaaatttctgcatgatatgaagataactcacaca
gatctcaaaccagagaacatcctctttgtggattctcgctcctccatcaaatatgatcca
gtcaagaagcgagacgtgaggcaagtagtgaattgtgacatcaggctgattgactttggg
tcagcaacgtttgaccatgaacatcacagcactatcgtttcaacgaggcattacagggca
ctggaggtcatcctagagcttggttggagtcagccatgcgatgtatggagtattgggtgc
atcatatttgagctgtatactggatttacactgtttcagactcatgataacagggaacat
cttgccatggccgagcgaatactgggtaactttccttcatggatgatcaagagaacaaga
aagagcaagtacttctaccatgaccgtgtggactggaatcaggacaactcatctggtcgc
tatgtctgtgagaactgccacccgtttcgctactaccttgacagcaatgctgatgagcac
cgccttctctttgataccattgaggagatgttagagtttgatcccttcaagcgggccaca
ttgagtcaggtcctggatcacccttactttgctgatattcactatcgagggaatagagac
atgcatagtatcagcaggtga

DBGET integrated database retrieval system