KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592667Help
Entry
592667            CDS       T01019                                 

Gene name
mgam
Definition
maltase-glucoamylase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    592667 (mgam)
   00500 Starch and sucrose metabolism
    592667 (mgam)
Enzymes [BR:spu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     592667 (mgam)
    3.2.1.20  alpha-glucosidase
     592667 (mgam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2147 aa AA seqDB search
MKEEMDIDEAVKSGRQRWSTSAVVAMALGITLVVVPLCVCLTYFLHPGYGLSDTDDDSPF
EPLPAEPDVRINCIPDRDQSPNEELCSNRGCLWMSPYSEGQPWCFFPEDFGAYHVMVEDN
MSWGTRIRLERHAEVPSFFGGVIQTLMIDIEHQTNDRIHFKIYDPSEPRFEVPVEMPSRP
EMKAENPNYDIMYTTNPFTLKITRKSTGEVLWDTSIGALIFEDQFLTISTRLPSTNIYGL
GESEHHSFRHDLNWLTWGVFSRDQPPSYKGNLYGVHPFYMCVENDANAHGVLLLNSNAQD
YSLQPTPALTYHTIGGVLDFYMFLGPNPESVVSQYTEAIGRPGLPPYWSLGYQLCRYGYG
NLSNVQEVVASMRQYQIPHDVQYGDIDYMNRQLDFTIHPTNYQGLGEWVDSLKPDGTRYI
IILDPAISANETEADYPPYKRGVDEEVFIEDENGGIRFGKVWPDYPGVVVDPSLPWDDQV
EQFRAYAAFPDFRKQSAQDWWKNEVDMFHDRVAFDGIWIDMNEPASFVHGSVDGCTENTY
DNPPFMPQIWGPTIYDKTICMNSVQHVTYGMKDTHYNMHSLYGWSQTEPTLQAAQEATEQ
RSLVISRSTFPSSGKHTGHWLGDNASIWPHLYYSIIGMLEFNLFGIPYIGADICGFFDDT
NEDLCRRWHQVGAFYPYSRNHNGLGNMPQHPAHFGEDFAIEVRDVLHIRYRLLPYLYTLF
YHAHTKGSTVVRPMMHEFTSDSNTWDIDRQFLWGPALLISPVLEPETTSVKAYFPVARWY
DYYTGMELSSDMLAVGGGVMLDAPMDYINLHVRGGHIIPTQNPDNSTMFSRRNEFGLIVA
LDNEMEAGGDLFWDDGETIGTIMNEQYYMFHYTFTNNMLTAEIAHSYSNLMDNLVMDHVM
IYGMDEAPSRVVLTDYNAVTEATFTFDQVNMALNVTGLNHAMDLGFTLTILYAHQATMEE
DDFERSALTKEKKPTGWTNQHVLALTLVVVACVATICTTLTFFLHPDYAGIDGVNPFEPA
PTEASVEERINCIPDKDVENAEELCSDRGCVWRPTIVDGAPWCFFPTGHGTYRLVKEEEH
TWGTRLTLERETYIASFFNQDIQTLSLDIEFQSQTRLHFKFYDASESRFEVPIPLLPRPA
EAARVTDYAITYTTRPFTLEITRKSTGEVLWDTSIGALIFEDQFLSISTRLPSSNLYGFG
ESEHRSFRHDMNWRTWGLFARDQPPGDAINLYSVHPFYMNVEYDGNTHGVLLFNLNAQDF
TVQPTPALTYRTVGGVLDFYMFLGPTPDQVIQQYTELIGRPMLPAYWALGYHLSRYGYDN
LTNLQDVVAGMREYDIPHDAQYSDIDYMDHNLDFTLDEENFGGLGEFVESLKPDGTRYII
MLDPAISANETGYEPYDLGIQDDIFIKDEFGNLRYGKVWPDYPNITVNDSVDWDTGVRLY
RAYAVFPDYMKQETREWWINQITKFKDRVNFDGLWLDMNEPANFLHGSVDGCNDNQYDFP
PYVPQISWGGPIYDKTICMNSVQHYDEGREETHYNMHSVYGWSQTIPTLTAVQNLTEERS
LVVTRSTVPSSGMYSGHWLGDNGSNWPQLRYSIIGTLEFNLFGIPHVGADICGFFNDSPE
DLCRRWHQVGAFYPYARNHNGIRYQEDGDLDVYKNRIVNGRNSGNVVSRDITVSFPITCF
YERVHRLEYGYSAIGSAGVVQQSLSDTGSYVSGTFGFAMYTDDTFTTKVNSSATDVPVNQ
RAYFAVEATTAADQRVVIDSCWTTPTTDEDSRRYNLITDGAVQNLTEERSLVVTRSTVPS
SGMYSGHWLGDNGSNWPQLRYSIIGTLEFNLFGIPHVGADICGFFNDSPEDLCRRWHQVG
AFYPYARNHNGIRYQPQDPAFYGREFAEHVRDILHIRYRMLPYLYTLFYYAHTQGSTVVR
SLMHEFTHDSQTWGIDRQFMWGPALLISPVLEENTLVVRAYFPLARWYDYYEGLEMPEES
LTVGGGIDLEAPLEYLPLHIRGGHIIPTQQPHNSTKFSRLNPFGLIVPLDGSMQASGDLF
WDDGDSIGTVESGEYYLMRYIFSSHILTSSFVHVPASHPSTMLNNLTMDDITIYGLERAP
SIVKFNGAQLGTGNFEFNEDTKVLSVASLEHPMTSVFTLAIELAETV
NT seq 6444 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagaaatggacatcgacgaggctgtcaagtcgggacggcaacgctggtcgaca
tctgccgtggtcgccatggctctcggcatcaccctcgtcgtcgtacccctctgcgtctgt
cttacgtacttcctccatccaggttacggactgagcgataccgacgacgacagccccttc
gaacctttgccggccgaacccgacgtccgtatcaactgcataccggacagggaccagtcg
cccaacgaggagctctgttctaatcgcggttgcctgtggatgtcgccgtactccgagggg
caaccatggtgtttcttccccgaggactttggcgcataccatgtcatggttgaagataat
atgagctggggtactcggatacgtctcgaacggcatgcggaggtgccttcgtttttcggc
ggtgtcattcaaacgttgatgattgatattgagcatcaaacgaatgacagaatccatttt
aagatctacgacccctcagaacctcggttcgaagtccctgtcgagatgccatcacggcca
gaaatgaaggctgagaatccaaactatgacatcatgtataccaccaaccctttcacactc
aagataacccggaaatctacaggagaagtattgtgggacacctcgattggggcactcatt
ttcgaggaccagttcctaaccatctcgaccagactgccttcgaccaacatctacgggttg
ggcgaaagtgagcatcacagtttccgtcatgacctaaactggctcacgtggggtgtattc
tcaagggatcaaccgccttcgtacaagggcaatctgtatggtgtacatccattctacatg
tgcgtcgagaacgacgctaacgcacacggcgtactgctcctaaactcaaatgcacaagat
tactcgttgcaaccaacacctgcactgacctaccacaccatcgggggagtcctggacttc
tacatgttccttggacccaacccagagtcagttgttagccaatacactgaggccatcggg
agaccgggtttgccgccatattggtccctgggctaccagctttgtcgctatggttatgga
aatctttcgaacgtgcaagaggtggttgcgtcaatgcgtcaatatcaaattccccacgac
gtccaatatggagatattgattacatgaatcgtcagctagactttaccatccacccgacc
aactatcaaggcctcggtgaatgggtagattccttgaagccagatggaaccagatatatt
atcatcctcgatccagccatttcagcgaacgagacagaagccgactacccgccttacaaa
cgtggagttgacgaagaagtcttcattgaagatgagaacggtgggatacgatttggaaag
gtttggcctgactaccctggtgttgtcgtggacccatctctaccatgggacgaccaagtc
gagcaattccgtgcttatgctgcttttcctgattttaggaagcaatctgcccaggactgg
tggaaaaatgaggtggatatgttccacgacagggttgcatttgacggtatctggatcgat
atgaacgaaccagcaagctttgtacatggttcggttgacggatgcacagagaacacctac
gacaatccacctttcatgcctcaaatctggggaccaacgatatacgacaaaacaatctgc
atgaattccgtacagcacgtgacatacggcatgaaggacacccattacaacatgcacagc
ctctacggatggagtcagacggagccgacgctacaagcggcacaagaggctacggaacag
aggagtcttgtcatctcacgatcaacctttcctagcagcggcaaacataccggtcattgg
ttaggagacaatgcttcgatctggcctcatctctattactccatcattggtatgctggag
ttcaacttgtttggtattccatatattggtgctgatatctgcggtttcttcgacgacact
aacgaggatctttgtcgtcgatggcatcaggttggagccttctatccctactctaggaat
cataatggtctaggcaacatgccacaacatcctgctcatttcggagaggatttcgccatt
gaggttcgcgacgtgcttcacatcagataccgtctcctcccgtacctctacacactcttc
taccacgcccatactaagggctcaacggtagtcagacctatgatgcacgagtttacttct
gatagcaacacatgggatattgacaggcagttcttgtggggtcctgcccttctcatttcg
cccgtcttagaaccagaaacaacaagtgtgaaggcatactttcccgttgctcgctggtac
gattactatactggcatggaattgtcatcggacatgctggccgttggtggcggtgtcatg
ctagacgctccaatggactacatcaaccttcacgtaagaggcggccacatcattccgacc
cagaatccggacaactcgaccatgttcagtcgaaggaacgagtttggtttgatcgtcgcc
ttggataacgagatggaggctggtggtgatctcttctgggacgatggtgaaacaatcggg
accatcatgaacgagcagtattacatgttccactatacatttacaaataatatgttgacg
gcagagatcgctcattcttattctaacttaatggacaatcttgtgatggaccacgtaatg
atctatggcatggatgaagcgccctctcgtgttgtactcaccgactataatgcagtcacg
gaagctacctttacgtttgatcaggtcaatatggctctcaacgtaaccggattaaaccac
gccatggatcttgggttcacccttaccatcctttacgctcatcaagcaaccatggaggaa
gacgattttgaacgttccgcgttaacgaaggagaagaagcccacggggtggaccaaccaa
cacgtgctcgccctaaccctcgtcgtcgtcgcctgcgtggccacgatctgtaccaccctc
acgttcttcctccatcccgactacgcgggcattgacggcgttaacccgttcgagcccgcc
cccacggaggcgagcgtggaggaacgtatcaactgcatccccgataaggacgtggagaat
gccgaggagctctgctccgaccgcgggtgcgtgtggcgaccgacgatcgtggacggcgcg
ccttggtgcttctttccgacggggcatggcacgtaccggctagtaaaggaggaggagcac
acgtgggggacgaggttgaccctggagagggaaacgtatatcgcttctttcttcaaccag
gacatccaaactctctcactcgatatcgaattccagtcgcagactagacttcatttcaag
ttttatgacgcctcagagtctcgcttcgaagttcccataccgctgctgccccgcccagcc
gaagcagctagagtcacagactacgccatcacgtacactacccgccctttcactctggaa
atcacccgaaaatcaacgggggaagtattgtgggatacgtctattggagcgctaattttc
gaagaccaatttttgtcgatctcaactcgtttgccttcttccaatctgtatggtttcggg
gagagtgagcatcgaagctttagacatgacatgaattggcggacttggggtctttttgcc
agggaccaaccgcctggggacgctatcaacctgtacagcgtccatcctttctacatgaac
gtggagtacgacggtaacacacacggtgtcctgctgtttaaccttaatgcacaagatttc
acagtgcagcctacccctgccttaacttatcgcacagtcggtggagttctggacttttat
atgtttcttggaccaacacctgaccaggttattcaacagtacaccgagttgattggtcgc
cctatgctgcccgcctactgggctcttggttatcatctcagcagatacggctacgataac
ctcaccaatctacaagatgtggtggcaggtatgagagaatacgacatacctcacgatgcg
cagtacagcgacattgactacatggaccacaaccttgacttcactcttgacgaagagaac
tttggtggtttaggagagtttgtggaatccctcaaaccagacggcactcgatacattatc
atgctggatccggccatttcagccaatgaaaccggttacgagccttatgacctaggcatt
caggatgatatctttatcaaggatgaatttggaaatctgcgatacggaaaagtgtggcct
gattaccccaatatcaccgttaacgattccgtcgattgggatacaggcgttaggctctac
cgtgcttacgcggtgtttcccgactacatgaaacaggaaacaagagagtggtggatcaac
cagataacaaagttcaaggatagagttaactttgatggtctctggctggacatgaatgaa
cctgccaattttctacacggatctgttgatggatgcaacgacaaccagtatgacttcccg
ccgtatgttccccaaatctcttggggaggtccgatatatgataagacgatatgtatgaat
tccgttcagcattacgatgaaggcagggaggaaacgcactacaatatgcacagtgtttat
gggtggagtcagactataccaacactcactgctgttcagaatttgactgaagagaggagc
ctggtagtcacccgatccacggtgcctagcagcggcatgtactctggccactggctggga
gacaatggctccaactggccccaactaagatactccataattggaacgttggagttcaat
ctctttggtatccctcacgttggggctgatatatgcggctttttcaacgatagcccagaa
gatctctgtcgcagatggcatcaagtgggggcgttctacccgtacgccagaaatcacaat
gggatcagataccaggaggatggtgacttagacgtatacaagaatcgcatcgtcaacgga
agaaatagcggtaacgttgtttcccgtgacatcactgtgtccttccccattacctgtttc
tacgagcgcgtacatcgtctggaatacggttactccgccatcggcagtgctggagtcgtt
cagcagtccctcagtgatacaggctcttatgtaagtggaacgttcggctttgcaatgtac
accgacgacacttttacgacaaaagtcaactcgtccgccaccgacgtacccgttaaccag
agagcctactttgctgtggaagccacgaccgccgccgatcagcgagtggtcatcgactct
tgctggacgaccccaacgactgacgaagacagcaggagatacaacctgataacggatggt
gctgttcagaatttgactgaagagaggagcctggtagtcacccgatccacggtgcctagc
agcggcatgtactctggccactggctgggagacaatggctccaactggccccaactaaga
tactccataattggaacgttggagttcaatctctttggtatccctcacgttggggctgat
atatgcggctttttcaacgatagcccagaagatctctgtcgcagatggcatcaagtgggg
gcgttctacccgtacgccagaaatcacaatgggatcagataccagcctcaggatcctgcg
ttctatgggagggaatttgccgaacacgtccgagatatactccacatcagataccgaatg
cttccctacctgtacactctgttctactatgcccacacacagggctccacggtcgtccga
tcactgatgcatgagttcacacacgatagccagacatggggaatagacaggcaatttatg
tggggaccagctcttctcatctcgcccgtcctcgaagagaacacactagtcgtaagggca
tactttcctctagctcgttggtacgattactacgagggtttggaaatgccggaggaatct
ttgactgtagggggcggcatagatctcgaggcacctcttgaatatcttcctcttcacatc
cgaggcggtcacatcataccgacccagcagccacacaactccaccaagttcagtcgtcta
aacccgtttggtctgatcgtgcctcttgacggatccatgcaagcttcaggcgatctcttc
tgggacgacggagattccatcggaacagtcgagagtggagagtactatctgatgcggtac
atcttttcaagtcatattctgacctcctcatttgtgcatgtgccagcgagtcacccaagt
acaatgttgaataacctgactatggacgatatcactatctatggactggagagggcacct
tccatagtcaagtttaacggagcccaacttgggaccggcaacttcgaattcaatgaagac
acaaaggttctttctgtggcgtctttggaacatccaatgacgagtgtcttcactttggca
atcgagttagctgagactgtctag

DBGET integrated database retrieval system