KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592703Help
Entry
592703            CDS       T01019                                 

Definition
uncharacterized LOC592703
Orthology
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   592703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 264 aa AA seqDB search
MRLAFALYTWIECRGGDDTLSPAEADDEPKKHVERSIQMFKEIGDLGKEAAASMVKGHLC
RDGSKEQREWYQIALEQCQQALGEKCKLMELIISSIGIYYEDKKNYSSAYDYFLKSRQLC
IEVLGDGHQRTILANSYLSHPYYRRIAKTKAAKPAKPSQPSQPSDGKKKRKRKDNYGIYI
YKVLKQVHPDTSISSRAMIIMNSFMNDIFEQIAVESSRLAQHNKKSTISSREIQTAVRLI
FPRELAKHAVSEGSKAVTKYTTSK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttgctttcgccctgtatacttggatagagtgtagaggaggagatgatacgctc
tctccagctgaagctgatgatgaacctaagaaacacgtagaaaggtccattcagatgttc
aaagagattggagacctcggtaaagaagcggcagccagcatggtcaagggtcacctttgt
cgagatggcagtaaagaacagagagagtggtaccagatagcccttgaacagtgtcagcaa
gcccttggagagaaatgcaaactcatggaacttatcattagcagtataggtatttactac
gaagacaaaaaaaactactcttcagcttatgactacttcttgaaatcgcgtcagctctgt
attgaggtgttaggggatggtcaccagcgcacaatcttagctaactcctatctgagccat
ccttactacagacggatcgcaaagaccaaggctgccaagcctgccaagccctctcagccc
tctcagcccagtgatggaaagaagaagaggaaaaggaaggacaattatggaatctacatc
tacaaagtcctcaagcaggttcatccggataccagtatctccagtcgggccatgatcatc
atgaacagcttcatgaacgacatctttgagcaaattgctgtcgaatcttcccgcctcgct
cagcacaacaagaagtcaaccatcagcagtcgcgagattcagaccgccgtccgccttatt
ttccccagagagctggcaaagcacgctgtgagcgagggttccaaagcagtgacaaaatac
actacctccaaatag

DBGET integrated database retrieval system