KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592988Help
Entry
592988            CDS       T01019                                 

Definition
glycogen debranching enzyme-like
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    592988
Enzymes [BR:spu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     592988
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     592988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1381 aa AA seqDB search
MSSQRLGTHGGIDLSTRGSTIIMASQIRKMILNEGEHKNTTLYRLKKGWTLHFQLGPSLQ
ARNVNVFTNHPPTGSGKPFSRKEFYQIGWEMASQSQCDTSERFCKVELGLAGAFQYYFTI
DNSTKEEGSGFFLVDPVLTIASETDILPLDCITAQTVLTKSLGPFSTWEDRLRVSHESGY
NVIHFTPIQELGASNSSYSIRNQHAINPSLDCNGNKVTLADVQGLVSKMQQEWGVLSICD
VVWNHTSFDSPWVKEHPECAYNVQNSPHLRPAYVMDRIFSHFSSEVMEGKWEGIGVPKII
DNEEQLHKIRHILTHEVFPQYKLQEFYQVDLEKTIEEFKERCKASKEATPQMESKPWEVA
IIQDKGYRRLASTIDMNKALDNFNIQKPGVDEPEARIQQCCQDLHKHLERLNGLAANVMG
EDTRQAIENLISNVRYHHIDPSGPKLVEVTKKNPLVNEYFKHPGPATNVQTDEALMDSAQ
APLLMASNGWVMGDDPLKNFAEAGSKVYLRRELINWGDSVKLRYGKGPEDCPYLWQHMLE
YTQKVVSVFHGVRIDNCHSTPIHVAEYFLDEGRKIRPDLYVMAELFTASEHIDNMFINRL
GISSLIREAMSAYDSHEEGRLVYRYGGEPVGSFLQPAVRPLQPSIAHALFMDVTHDNQSP
VQVRSVYDLLPSAALVSMACCAIGSTRGYDELVYEQIHVVDEKRFYTSWNEKPKDGTEVN
FDKGIIGAKRALNELHQSLGDQGYTQGWGEVDENIVAVTRHCPVSHLSVILVARTAFKHP
HNARYTGHIPPLCIPGSVEEIILEARLVQQDAESTPPSSSHITGLSNYSVQMQTHVTLLN
SEVCELLEHGSQAQASLQEIDFINFPPGSVIAFKVVPHPSARAALSSLRSCIAQFGYRVR
TLSGTSPMRANNNSSFHTLAEKLSLTDMNHVLYRCDNEERDDGKGSATYDIPNHGKLVYC
GLQGFMAVLADIRTKNDLGHPMCENLRQGDWMPGYVANRLKLKPATKQLGLWFEKAFAPL
TQIPRYLIPCYFDAIMVGAYTVILDLAWKTMNLFVSDGSSFVRFLALGSVQMCGIVKTSP
LPVMSPSLEGVPTALDEETGKYIQSSPTMSAGLPHFSSGFMRCWGRDTFLALPGLLLVTG
RADEAKHLILAFAGTLRHGLIPNLLGGGDHARFNCRDAVWFWLYCIQLYTKTVKDGISIL
EAPVSRIFPSDDADPHPPGFAAYTKRSVEEIILEVRLVRRDEESTPPSSSHITGLSNKRS
VEEIILEARLVQQDAESTPPSSSHITGLSNYSVQMQTHVTLLNSEVCELLEHGSQAQASL
QEIDFINFPPGSVIAFKGLPATPRDGSPVEIVGLCKAAVRWLAALHKEGKFPHDGVTVRI
E
NT seq 4144 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcagaggctcggcacacatggtggtattgacctttcaacccgggggtcaacg
atcatcatggccagtcagatcaggaagatgatcctcaatgagggggaacataaaaacaca
actctctacagacttaaaaaaggatggacactgcacttccagctaggcccatccctacag
gcaaggaatgtgaacgtcttcaccaaccatccccccacaggttcagggaaacccttcagc
cgtaaggagttctaccaaatcggttgggagatggcatcccaatcgcagtgtgatacgtca
gagagattctgtaaggtggagctgggccttgcaggagcatttcagtactacttcactatc
gataacagtaccaaggaggaaggctcagggttcttcttggtagaccctgtcctcaccatt
gcttcagaaacagacatccttcctctggactgcatcactgcacagacagtactcaccaag
agccttggtcccttctctacctgggaggatcgcctgagagtcagccatgagtccggttac
aacgtcatccacttcacgccgatccaggagcttggcgcgtcaaactcctcgtactccatc
cgcaaccagcatgccatcaacccctccctcgattgcaacggtaacaaggtcactcttgcg
gatgtccaaggtctggtgtccaagatgcagcaggagtggggcgtcctcagcatatgcgac
gttgtctggaaccacacctcctttgacagcccttgggtcaaggagcatccagagtgtgct
tacaacgtccagaactcaccgcaccttcggccggcgtacgtcatggatcgtatcttctcg
catttcagctcggaggtgatggaggggaagtgggaaggtattggtgtcccaaagatcatc
gacaatgaggaacaattgcataaaataagacatatactgacacatgaagtcttccctcag
tacaagctgcaagagttctatcaagtagatcttgagaaaaccattgaagaattcaaagaa
agatgcaaagcttccaaagaagccacgccccagatggagagtaaaccttgggaggtggct
atcatccaggataaaggatacaggagattagctagtactatcgatatgaacaaagccttg
gacaacttcaatatacagaagcctggagtcgacgaaccagaggctcggatacagcaatgc
tgccaggatctccacaagcatcttgaacgtctcaacggcttggctgccaacgtgatgggc
gaggatacacgacaagccattgagaatctcatatccaacgtccgctatcatcatatagat
ccaagcggtcctaagttggtggaagtcaccaagaaaaaccctctcgtcaatgagtacttc
aaacaccccggacctgccaccaatgtccaaacagatgaagcattaatggactccgcccaa
gcccctctactcatggcgtccaatggatgggtcatgggggatgaccctctcaagaacttt
gctgaagctggctccaaggtatatctgagacgagagctcatcaactggggtgacagcgtc
aagctacgatacggaaaaggtccggaagattgcccgtatctatggcaacacatgctggag
tacacgcagaaggtggtgtctgtgtttcatggtgtccgtatcgataactgccacagtact
cctattcatgttgcagagtatttcttagatgaaggacgtaagattcgaccagacctgtac
gtgatggctgagttgtttactgcatctgaacacattgataacatgttcatcaacagatta
gggatatcttcactaatacgagaggccatgagtgcatacgactcacacgaggaagggcgt
ttggtctaccgttacggaggggaaccggtcggttcgttcctccaaccagcagtgcgccct
ctacagccaagtatagctcatgctctattcatggatgtaactcatgacaaccaatctcca
gttcaggtgcggtcagtatatgatctcttacccagtgctgccctggtatcgatggcttgc
tgtgctataggatccaccagagggtatgatgagctggtctatgagcagatccatgttgtg
gatgagaagcgattttacacgtcatggaacgagaaacctaaggacgggacggaggtcaac
tttgacaaaggtatcatcggggctaagagagcgttgaatgagcttcatcagtcgctcggt
gatcagggttatacacaggggtggggagaggtggatgagaacattgtagccgtcacacgt
cactgccccgtttctcacctctctgtcatcctggtcgcccgcacagctttcaaacatcct
cataacgcacgctacacgggacatatacctccgctatgtatacctggatccgttgaagag
atcatcctggaggcgaggctcgtccagcaggatgcggagagtaccccgccctcctcctca
cacatcaccggtctatccaactacagtgtccagatgcagacccatgtaacgctactcaac
agcgaggtgtgtgagctgctggagcatgggagccaggctcaagcttctcttcaagagata
gactttattaacttccctcctggcagtgttatcgcattcaaagttgtaccccacccctct
gctcgagccgccctctcttccctgcgatcctgtattgctcagtttggctaccgtgtcaga
accctcagtgggaccagccctatgagagccaacaacaactccagcttccacaccctggca
gagaagctctccctcacggacatgaaccatgtcctctaccgatgcgataacgaggagagg
gatgatgggaaggggtcagcgacctatgacatcccaaatcatggcaagctggtctactgc
ggcctgcaaggtttcatggcggtgctcgcagatatcagaactaagaatgacctgggtcat
cccatgtgtgaaaacctcagacaaggtgactggatgcctggctatgtagctaacagactc
aagctaaagcccgccacaaaacagcttggtttatggtttgagaaagcattcgcacccctc
actcagatcccacgctacctcataccatgttacttcgatgctataatggttggagcttac
acagttatactggacttggcatggaagactatgaacttatttgtatccgatggatcttcc
tttgtgcgattccttgctcttggctcggttcagatgtgcggtatcgtgaagacctcaccc
ctgcctgtcatgtcgccgtccctagagggcgtaccgacagctctagacgaggagacgggg
aagtacatccagagctcccccaccatgtcggctgggcttcctcacttctccagtggtttc
atgcgatgctggggaagggacacgttcctcgctctaccaggattgctgcttgtgactggg
agagcagatgaggcaaagcacctgatcctagccttcgctggcaccctacgtcatggactc
atccccaacctcctgggaggaggggaccacgcccggttcaactgccgggatgcggtctgg
ttctggctctactgcatccagctctataccaagactgtgaaagatggcatctctatcctg
gaagcccctgtctctaggatcttcccctctgatgatgctgacccgcatcctcccggcttt
gcggcatacaccaaaagatccgttgaagagatcatccttgaggtgaggctcgttcgacgg
gatgaggagagtaccccgccctcttcctcgcacatcaccggtctatcaaacaaaagatcc
gttgaagagatcatcctggaggcgaggctcgtccagcaggatgcggagagtaccccgccc
tcctcctcacacatcactggtctatccaactacagtgtccagatgcagacccatgtaacg
ctactcaacagcgaggtgtgtgagctgctggagcatggtagccaggctcaagcttctctt
caagaaatagacttcattaacttccctcctggcagtgttatcgcattcaaagggctccct
gccacaccaagggatggatcaccggtagagatagtaggtctatgcaaggcagcagtgagg
tggctagcagcactgcataaagaagggaaattccctcatgatggagttactgtaaggata
gaag

DBGET integrated database retrieval system