KEGG   Strongylocentrotus purpuratus (purple sea urchin): 593427Help
Entry
593427            CDS       T01019                                 

Definition
UDP-glucuronosyltransferase 1-1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    593427
   00053 Ascorbate and aldarate metabolism
    593427
   00500 Starch and sucrose metabolism
    593427
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    593427
   00860 Porphyrin and chlorophyll metabolism
    593427
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    593427
   00982 Drug metabolism - cytochrome P450
    593427
   00983 Drug metabolism - other enzymes
    593427
Enzymes [BR:spu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     593427
Glycosyltransferases [BR:spu01003]
 Others
  Hydrophobic molecule
   593427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 325 aa AA seqDB search
MSFCERVGSFLEHHLIAKLLGWSHFGALNEVKDKHGIAPGRSIPDLLGEAELWMCMTSFA
FDFPRPTTPNWIELKGLTDIPVKPLPQDYADFVDGSGDHGFIVFSLGTHFSELPKPGMAE
AFARVFSELPQRVIWRYTGPRPRYLGNNTMLVKWMPQNDLLGHPKARLLIYHGGLAGIYE
AISHAVPMVIMPIFADQPSNAVRVEAKGMGRVIEKDSITYETVKEAVVDVLENPSYLENI
RRYSGIYRDSITKPDDVVGFWVEHILKFGGSHLRSRALELSFIQLHSIDVLAFIVGIIAV
IVFLLYTCCKRCLSCCLKSKKTKIE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtccttttgcgagcgagttggaagcttccttgaacaccacctgatcgcgaaattacta
ggatggtcccactttggcgctttgaatgaggtgaaggataagcatggtatcgctccaggt
cgaagcattccagatctcttaggagaagcagagttgtggatgtgcatgacgagtttcgca
tttgattttccccgacctaccacaccgaattggattgagctgaagggtctcacagacatt
cccgtgaagcctcttccgcaggactatgcagacttcgttgatggatcgggcgatcatggt
ttcatcgtattttcattgggtacacactttagcgagcttccaaaaccagggatggcagag
gcctttgcaagagtcttcagtgagcttccacagagagtcatctggcgctatactgggcca
cgccctcgttaccttggtaacaacaccatgctggtaaaatggatgccacaaaatgaccta
ctaggtcacccgaaagcccggctcctcatctaccacggcggcctcgcgggcatttacgaa
gccatcagccacgccgtccctatggtcatcatgccaatcttcgccgatcaaccctcaaac
gcggtcagggtcgaggctaaaggaatggggagagtgattgagaaagactccatcacgtac
gagaccgtgaaggaagctgtggtcgatgtccttgaaaatcccagctacttagaaaatatc
cgacgatattcaggaatctacagggattccataaccaaaccggatgatgttgttggcttc
tgggtggaacacatcctcaaatttggagggtcacacttgagatctagagccttggaactc
agcttcatccagcttcattcgatcgacgttctcgctttcatcgtcgggatcatagctgtc
atcgttttccttctctatacgtgttgtaagcgatgtctatcatgttgcttaaaaagcaag
aaaacgaaaatagaataa

DBGET integrated database retrieval system