KEGG   Strongylocentrotus purpuratus (purple sea urchin): 594062Help
Entry
594062            CDS       T01019                                 

Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    594062
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     594062
Peptidases [BR:spu01002]
 Serine Peptidases
  Family S33
   594062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 323 aa AA seqDB search
MAEKPSESTLKNADGLNIFCRYWYPDNKDVRALVHVIHGVGEHIGRYDAVAASFTKLGCL
VYGHDHVGHGRSEGVKVDVKDFQLYVKDCLQHTTIMTEKYPNLPVIAFGHSMGGTIAILM
MNSHSSRFAGAIFGSPCVAPSQATPFLIFMARGAAYMFPQLAVAKLVVSDICRDPAVVED
YVKDPLVWHGGVKARWAVKMYDACMQIQAECEHKANYPFLLQHGSKDAICDIKGSDLFFE
RSKSQSKVYKKYEGYFHELDKEPEGEREVVFKDMEDWTRDLLDSLEGSKVDGPKVNGPKV
NGPKVDGPIGTETASPSDVDVKS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaaaccgagtgaaagcacattaaaaaatgcggatggattgaacatattctgt
aggtactggtatccagataataaagatgtgagagccctagtgcatgttattcatggagta
ggtgaacacattggccgttatgatgctgttgcagcttctttcaccaaactaggatgtctt
gtatatggccacgaccatgttggccatggacgtagtgagggtgtgaaagttgatgtgaaa
gacttccagttgtatgtcaaagactgtctccaacatacaaccattatgacagagaagtat
cccaaccttcctgttatagcctttggtcattccatgggaggtaccattgcaatcctgatg
atgaattcgcattcaagtaggtttgctggagctatatttggatccccttgcgtagcacca
tcacaggccacgcccttcctgatattcatggccagaggagctgcatacatgttccctcag
cttgcagttgcgaaattagttgtgtcagacatttgcagagatccggctgtggtagaagac
tacgtcaaggatcccttggtatggcatggcggggtcaaggcacgctgggcggtcaagatg
tacgatgcatgcatgcagatccaggcagagtgtgaacacaaagccaactatccattcctc
ctccaacatggctccaaggatgccatatgtgatatcaaaggatcagatttattctttgag
agatccaaaagtcagagcaaagtctacaagaaatacgaaggctacttccatgaattggac
aaggagccagagggagagagagaagtggtcttcaaggacatggaggactggactagggat
ctcctcgacagcttagaggggtcaaaggttgatggaccaaaggtcaatggaccaaaggtc
aatggaccaaaggtcgatggaccaatcggaacagagacggccagtccaagtgatgtagat
gtaaaatcgtga

DBGET integrated database retrieval system