KEGG   Strongylocentrotus purpuratus (purple sea urchin): 594211Help
Entry
594211            CDS       T01019                                 

Definition
lymphokine-activated killer T-cell-originated protein kinase-like
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 344 aa AA seqDB search
MASTEDKATKGSLKNVSSDFLTPVHPAKRSRVSVATPARNSPATKLQIPASPFMKKLGWG
TGVSVYLLERSPRPDGSGRSPWAVKKIRSKYKKGRGDVDVEGRLKKEAVILKKMSHANIV
EFRALSKSADGSLCLSMENGQQSLMGMIDQRKEAGKGPFPAAQIYQVALSLASALNYLHN
DLKYIHGDLKSGNVLVKGDFETVKLCDFGVALKLTDDLNGLENPTDDYVGSQPWNAMEVH
MAGDITHKTDMFSYGLVIWEMMSLEAPHLDLLFSGDDSEYDDDETSFDESEFEAALGTRP
PLPKENLGPAYQFLIELFCACTIEDPTQRPSAKMTLAALEDVML
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacagaggataaagctaccaaaggctccctgaagaacgtgagttcggatttc
ctgacccccgtgcatccggcgaagagaagtcgagtctcggtggctacccccgcccggaac
tctcccgctaccaagcttcaaattcccgcttctccatttatgaagaagcttggttgggga
actggcgtgtcagtttatttgctcgaaaggagtccaaggcctgacggtagtggacgttca
ccatgggctgtcaaaaaaatccgcagcaagtacaaaaaaggcagaggagatgtagacgta
gaaggaaggcttaaaaaggaagcagtaattcttaagaaaatgagccatgctaacatcgtg
gagttccgagcccttagcaagtcagctgatggatcgctgtgtctgtctatggaaaatggt
caacagtccttgatgggtatgatcgatcaacgcaaggaagcgggaaaaggtccattcccg
gcagcccagatctaccaagtggccctgtccctggcctcggccctgaactaccttcacaac
gacctcaagtacatccacggtgacctcaagagtggcaacgtcctggtcaagggcgacttt
gagacggtcaagctctgcgatttcggagtcgcactcaaactgacggacgacttgaacggc
ctggagaaccctactgatgactacgtcggctctcagccatggaatgctatggaggtccac
atggccggtgacatcacgcataagacggacatgttctcatacggtctggtcatctgggag
atgatgtccctagaggccccccatcttgatctactttttagtggagatgacagcgagtat
gacgacgatgagacaagctttgacgagtctgagtttgaggcagcattgggaaccagaccc
ccgctacccaaagagaacctaggacccgcgtaccagttcctcattgaactcttctgtgcc
tgtaccatcgaagaccccacccagaggcctagtgctaagatgactctcgctgccctggaa
gatgtgatgctctag

DBGET integrated database retrieval system