KEGG   Strongylocentrotus purpuratus (purple sea urchin): 594665Help
Entry
594665            CDS       T01019                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     594665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 594665
NCBI-ProteinID: XP_011681833
Position
Un
AA seq 684 aa AA seqDB search
MFPEAEASESIEATSTEAMGGPAIGTLDIFLLSLSVGVGVYWFFFRKKAENKTEGLVNPI
TSSSMTMSSNSGSGFITKMKSSSRNVVVFYGSQTGTGEEFSVRLAKEAQRYGLKGMVADP
EENEMEDLSQLADIENSLAIFCVATYGEGDPTDNAQEFYDWLQDGNGDLSGVKYTVFGLG
NKTYEHYNAMGKYLDKRLEELGGERIFELGLGDDDQNIEEDFVTWKDRFWPAVCEYYGLE
ATGDESNIRQYAVTEHTEDVPEKVFSGEVARLNAFKNQKPPYDAKNPYLSAITVNRELHQ
GGDRSCMHIEFDISGSRIRYESGDHVAVYPTNDPELVAAIGKILDADLDTVFTLTNVDEE
ASKKHPFPCPTSYQTAFSHYLDITSCPRANVLKEISEYATDPADKEKLLLMSSATPEGKK
EYSDWVTKCHRNIVAILEDLPSVKVPLDHLCELLPRLHARYYSISSSPKVSPDRISITAV
LIRYTTPTGRIGKGVATNWLKDKIPNGPETTPFRVPIYVRKSQFRLPFKTTTPVIMVGPG
TGLAPFRGFIQERDFYRKDETKKVGDSILFFGCRKSTEDYIYKDELDEYLKNGTLTDIHV
AFSRETEEKLYVQHLMKRCQKQIWGMLEKGSHIYVCGDARFMAPDVQRTIREIICQEGGK
TQTEAEDYIKKMQSKGRYSCDVWS
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctgaggctgaagctagtgaatcgatagaagctacatcaaccgaagccatgggt
ggaccagcgattggtacgctcgacatcttcctcctcagtctgagtgtaggagtgggggtc
tactggttcttctttaggaagaaggcggagaataagacagaaggactggttaatcccatt
acaagttcctctatgacaatgagctcaaacagtgggtcaggatttatcacgaaaatgaag
tcatcttctaggaacgtggtagtgttctatggttctcagacgggtacaggggaagagttt
tcagttcggctggccaaggaagcccagcgttacggtctgaagggcatggtagcagacccc
gaggaaaacgagatggaggacttgtcccaactagctgatatagagaactcacttgctatc
ttctgtgtggctacgtatggtgaaggagacccaacagataatgctcaagagttctacgat
tggttacaggacggcaacggtgacctctcaggggtcaagtacactgtgtttggccttggc
aacaagacctatgaacactataatgccatgggcaagtatttggacaaacgattagaagag
cttggcggagagaggatatttgaacttggattgggagatgatgaccaaaatattgaggaa
gattttgtgacatggaaggatcgtttctggcctgcagtctgtgaatattatggattagaa
gcaacgggtgatgaatcaaacatacgtcaatatgccgtgacagaacacaccgaagatgtc
cctgagaaggtgttcagtggtgaagtggccaggcttaatgcattcaagaaccaaaaacca
ccatacgatgccaagaacccatacctgtctgcaatcaccgtcaatcgtgagcttcatcaa
ggtggtgacagatcctgtatgcacattgagtttgacatctcaggatcaagaatcaggtat
gagagtggtgatcatgttgctgtatatcccaccaatgatcctgaattggttgctgccatc
ggtaaaatcctggatgctgatctggatacagtcttcaccctgaccaatgttgatgaggag
gccagtaagaagcatccgttcccctgccctaccagctaccagactgccttttctcattac
ctggacatcacctcatgccctagagccaacgtcctgaaggagatctcagagtatgccacc
gatcctgcagacaaggagaagctcctcctcatgagttcagctacgccagagggcaagaaa
gaatacagcgactgggtgaccaaatgccatcggaacatcgtggccatcttggaagacctt
ccttctgtcaaggttcctttggaccatctgtgtgaactgcttcctcgtctccacgctaga
tactactccatctcatcgtctccaaaggtgagccccgacaggatatccatcactgctgtc
ctcatccgctacaccacacccaccggaaggatagggaagggcgtggccaccaactggctc
aaagataagatccctaacgggcccgagaccacccccttcagggtacccatctacgtgcgc
aagtctcagttcaggctgcccttcaagaccaccacgcctgtcatcatggttggacctggg
accggtctggctccattcaggggcttcatccaagagagggacttctacaggaaggatgag
accaagaaggtaggtgacagcatcctgttcttcggctgccgcaagagcaccgaagactac
atttacaaggacgaactggacgagtacctcaagaacggaaccttgacggacatccatgtg
gccttctcgagagagactgaagagaagctctacgtccagcacctgatgaagaggtgtcag
aagcagatctggggcatgctggagaaaggcagtcatatctacgtctgtggtgatgctcgt
ttcatggcacccgacgtccagcgtaccatccgtgagatcatctgtcaagaaggaggcaag
acgcagacagaggcggaggattacatcaagaagatgcaatcaaagggacgctattcctgt
gatgtctggagctag

DBGET integrated database retrieval system