KEGG   Strongylocentrotus purpuratus (purple sea urchin): 594677Help
Entry
594677            CDS       T01019                                 

Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00511  Other glycan degradation
spu00600  Sphingolipid metabolism
spu01100  Metabolic pathways
spu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    594677
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    594677
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    594677
Enzymes [BR:spu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     594677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 594677
NCBI-ProteinID: XP_799203
Position
Un
AA seq 522 aa AA seqDB search
MEACSCFTTSCVVLLLLAVQLTTCTTAIPCHQQRFPGGDTFVCVCNSTYCDTVEDYEPMQ
SGHFTVYTSSNTTGDRLTKRVYPISTTSNSTGSTVTIKIDKATRYQSVIGFGGCTTDAAT
INAFSLSNSSRHNLMKSYFSQDGIEYTLSRVPIGCTDLSTHYYSYDDHPGDFNLDNFSLA
TEDFKYKIPFIQEAMSVSRRGIKLFGSPWTPPIWMKTNNNYKGPGQIFGNPGEKYYKTWA
NYFIRFFEEYRKHNVTFWGVTVENEPMAGGINNYKTPSCYFTPEMERDFIKLDLGPALHA
NGFGDLELMMLDEQRYELPGWPEVVLTDADARSYVSGIGIHWYWDKETPLLKLDLTHMYF
PDFFMLYTEACNGRPATLGLWAEGESYSQSIMENMNHWVSGWTDWDMALNLEGGPSFTGN
LLNAPIIVDAEKDVFYKQPMFYHLGHFSKFIVPDSHRIPHTVDSDTKLLSIAFQLPDQHT
YAIVLLNKEDQAVDVTISDPDVGYINARIPAESIQTYLWTDK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggaagcttgttcttgttttacaactagctgtgtggtattgctcctactcgccgtgcag
ttaaccacatgtacaactgccataccatgtcaccaacagcgctttcctggaggggacaca
tttgtgtgcgtctgtaactccacctactgtgatactgtagaggattatgagccgatgcag
tctggccacttcacggtatacacctccagcaatacaacgggagatcgtctaaccaagagg
gtgtatcccatctcaacgacatcaaattctacaggttccaccgttaccatcaagattgac
aaggccaccagataccagtcagtcattggattcggtggatgtaccactgatgctgcaaca
atcaatgcattcagcctctccaacagttccagacataacctcatgaagtcttacttctcc
caggatggtattgagtacaccttaagccgtgtacctataggctgtactgacctatccact
cactactactcctacgatgatcatcctggggactttaatcttgacaacttctctctagct
acagaggatttcaagtataagatccccttcattcaagaagccatgtccgtgtctcgtcgt
ggtatcaagctctttggtagcccctggaccccacccatatggatgaagactaataacaac
tataaaggaccgggacagatctttggcaatccgggagagaaatactacaagacatgggca
aactattttatcaggttttttgaggagtacaggaagcacaacgtgaccttctggggcgtg
acggtggagaacgaaccaatggcaggtggcatcaacaattacaagaccccctcctgttac
ttcacccccgagatggagagggacttcatcaagctcgacctgggacctgccctacacgcc
aacggctttggtgacctggagctgatgatgctggatgagcagaggtatgaattacctggc
tggcctgaagttgtgctgactgatgcagatgccaggtcttacgtgtctggcattggtatc
cattggtactgggacaaggaaacgccccttctcaagctcgacctgacgcacatgtacttt
ccagacttcttcatgctgtacacagaggcctgcaacgggagaccagcaaccctgggctta
tgggcggaaggagagagctacagccaaagcatcatggagaacatgaatcactgggtgtct
ggttggacggactgggatatggctctcaatctcgaaggcggaccatccttcaccggaaac
cttctcaatgctcctatcatcgtggatgcggagaaagacgtcttctacaagcaacccatg
ttctaccatctgggtcacttcagcaaatttattgttcctgactctcaccgtataccccac
accgtggattcagacactaagttactgagtattgctttccagctaccagatcaacacacc
tatgcaatcgtccttctaaataaggaggaccaagccgtggatgtgactatatcggaccct
gatgtgggttatatcaatgctaggataccagccgaatctattcagacctacctctggaca
gacaagtaa

DBGET integrated database retrieval system