KEGG   Strongylocentrotus purpuratus (purple sea urchin): 752338Help
Entry
752338            CDS       T01019                                 

Definition
serine/threonine-protein phosphatase PP1-beta catalytic subunit-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    752338
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     752338
Protein phosphatases and associated proteins [BR:spu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     752338
Transcription machinery [BR:spu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     752338
Spliceosome [BR:spu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    752338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 324 aa AA seqDB search
MADLELDIDSILTRLLEARGRPYKSVNLTEAEVRGLCVKSREIFLSQPILLELEAPLKIC
GDIHGQYTDLLRLFEYGGFPPDSNYLFLGDYVDRGKQSLETVCLLLSYKIKYPENFFLLR
GNHECASINRIYGFYDECKRRYNIKIWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQC
MEQIRRIMRPTDVPETGLLCDLLWSDPDKDVSGWGENDRGVSFTFGNDIVGKFLNRHDLD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKK
AKYQYAGINSGRPGTPPKGQAKKK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttggaattagatatcgacagcatactcactcgtctcctcgaagcaagaggt
agaccgtacaaatcagtaaatctaacagaagcagaagtaagaggcctatgtgtcaaatca
agagaaatattccttagccaaccaatcttattagaattagaagctcctctcaaaatatgc
ggtgacattcacggtcagtacacagatctacttaggttattcgagtacggcggtttccca
cccgattccaactaccttttcctgggtgactacgtggacagaggcaagcagtccctggag
acggtctgccttctcctctcctacaagatcaagtacccagagaacttcttcctcctcaga
ggcaaccatgaatgtgccagcatcaaccgaatctacggcttctacgacgaatgtaagagg
cggtacaacatcaaaatctggaaaacatttacagattgtttcaactgcttgcctgtggct
gccatcgttgatgagaaaatcttctgctgtcatggaggcctttcacctgaccttcagtgt
atggagcagatcaggagaataatgagaccaaccgatgtcccagaaacaggtcttttgtgt
gacctgctgtggtcagatcctgacaaggacgtatcagggtggggcgagaatgaccgtggc
gtctcgttcacatttggcaacgacatcgtgggcaagttcctcaacagacatgatctagac
ttgatctgcagggctcaccaggtcgttgaagacgggtacgagttctttgccaagcgtcag
ctggtgacgctgttctcggcccccaactactgtggagagtttgacaatgcaggaggaatg
atgagtgtggatgaaacgctcatgtgctcatttcagatcctgaaaccatcagagaagaag
gccaagtaccagtatgccggcatcaactccggcagacctggcacccctcctaaaggacag
gcaaagaagaagtag

DBGET integrated database retrieval system