KEGG   Strongylocentrotus purpuratus (purple sea urchin): 752410Help
Entry
752410            CDS       T01019                                 

Definition
arginase-1-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    752410
  Amino acid metabolism
   00330 Arginine and proline metabolism
    752410
Enzymes [BR:spu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     752410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 378 aa AA seqDB search
MALNITQCCSRLVSSWMRRTSSGCHKAVRHASMASRLQSIGVLGVPINKGQDKDGVVYGP
TVLRDAGLISSIQDLGHTVIDHGDLVFPAGDEETATVNGVKNAAFLGKALKKISKGVEDI
TKQDQLCVTLGGDHGITIGSLHGHTRSRPDLCVLWVDAHADINLPQASPSGHIHGMVLSF
VCHELRHYLPKLPNFDWLDSCISCKDIAYIGLRDVDVGERYILEKHGIKIFSIHEVQKYG
VAEVYARAMDMINPRGTRPVHMSFDIDSLDPGVSASTGTPVLGGLTYREGIYIAEEIAET
GMLSSMDLVEVNPQLGTPSQQESTINAGVDVILAAMGKRKQGNVPVGYEILIPDERNRFA
PQKSDEAERLRRERNVQR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaatattacccagtgttgctccagactagtatctagttggatgagaagaacg
tcttctggttgtcataaagcagtccgtcatgcgagtatggcatcaagacttcaaagtatt
ggagtgttaggagtaccaatcaataagggccaggacaaagatggtgttgtatatgggcct
acagtgttaagagatgctgggctgatatcatccattcaagatcttggtcatacggttatc
gatcatggagaccttgtcttccctgcaggggatgaggagacagctacagtcaatggtgtc
aaaaatgctgcattccttggtaaagcactcaaaaagatttccaaaggagttgaagacatc
accaaacaggaccagctttgtgtaactcttggtggagatcatggcatcactatcggttcc
ctccatggccacacccgctcaagaccggacctgtgcgtcctgtgggtcgacgcccatgcc
gacattaaccttcctcaggcatctccgtccgggcacatacacggcatggtgctctccttt
gtgtgtcatgaactgcgccattacttgcctaagcttccaaactttgattggttggattcc
tgtatctcctgtaaagatattgcctacattggtctgagggatgtggatgtaggagagaga
tatatcttagagaagcatggaatcaaaatattttcgattcatgaggttcagaagtatggt
gtggcagaggtgtatgctcgggctatggacatgattaacccaagaggaacgcgtccagta
cacatgagctttgacatagactcattggaccctggtgtatcggccagtacagggacacca
gtacttggaggtctgacgtatagagaaggcatttacattgcagaagaaatcgctgaaaca
ggtatgctgagctctatggacttggtagaagtgaacccgcagcttggaaccccatcccag
caggaatctaccatcaatgctggtgtagatgtcatcttggcagctatgggcaagcggaaa
cagggcaacgtacccgtgggctacgagatcctcataccagacgagagaaatcgattcgcc
cctcagaagtcagatgaggcagagagactgaggagagaaaggaatgtgcaacgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system