KEGG   Strongylocentrotus purpuratus (purple sea urchin): 752535Help
Entry
752535            CDS       T01019                                 

Definition
replication protein A 32 kDa subunit-like
Orthology
K10739  
replication factor A2
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    752535
   03420 Nucleotide excision repair
    752535
   03430 Mismatch repair
    752535
   03440 Homologous recombination
    752535
   03460 Fanconi anemia pathway
    752535
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 86 aa AA seqDB search
MFNNQGGFDGFGNDQGGQGMGGGGFNSPGLGGGFNSPGVGASQSKAKRAQKIIPCNIAQI
MQAAQNENDFKIGDVEIHQVIIFLCK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacaatcaaggaggttttgatgggtttggtaatgaccaaggagggcaaggcatg
ggaggaggtggcttcaattcacctggattagggggaggattcaactcaccgggagtcgga
gcatcacagtctaaggcaaagagagcacagaaaatcataccatgtaacattgcacagatc
atgcaggcagcacagaatgaaaatgatttcaaaatcggtgatgttgaaattcatcaggta
attatatttttatgcaaatga

DBGET integrated database retrieval system