KEGG   Strongylocentrotus purpuratus (purple sea urchin): 754019Help
Entry
754019            CDS       T01019                                 

Definition
(RefSeq) malonyl-CoA decarboxylase, mitochondrial
  KO
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    754019
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    754019
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    754019
Enzymes [BR:spu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     754019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 425 aa AA seqDB search
MACKARLMSSSSGHGCAVTIQSQFLEAKVPQLMSNSTERGNQHSPWIPDSTVQEVCDHYQ
GLADEGKSNFMSAVASGMGVRHDKILTEASQLQSQVGREDAAILQAEKRLRQSLIPGYST
LFSHISRLQGGVKFLVDLRADLLDYLFSRPSLPNEAELKALNDTLKDLLIGWFAAGMLNL
ERVMWSSSCDMLEKISQYEAVHPVRNWTDIKHRVGPYRRCFVFTHSSMPNEPLVILHTAL
TRDISASIQSIVRKQNDIAVGVKSGEENPEEAQAAIFYSITSTQKGLQGVELGNHLIKSV
VKELQSEFPSMHLFSSLSPIPGFRDWLISQINKQVKDEHNTSLFTSQELDSFKSALNITS
LQALSTLKKVIVTNEWVKSESLVKSLQSPLMRLCARYLYVEKRRKMALNPVANFQSSEWS
QPCGA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcaaagcgcgactgatgtcatcctcgagtggacatgggtgtgcagtgacaatt
cagtcccagttcttagaagctaaagttccacagctaatgtcaaactcaactgagagaggg
aatcagcattcaccatggatacctgattcgactgtccaagaagtctgtgaccattaccag
gggctagccgatgagggcaagtcaaacttcatgtctgctgtggcatcaggaatgggtgtg
agacatgacaagatcctaacggaagccagtcaactgcaatcccaagtgggtcgtgaggat
gcggctattctccaggccgagaagcgtctgcgtcagtccctcatcccaggttactccact
ctcttctcccacatcagtcgacttcagggcggggtcaagttccttgttgatctacgagca
gacctactggattatttattttctcgaccatcactcccaaacgaagctgaattgaaggcg
ttgaacgacacattaaaagatcttctgattggttggtttgctgccggcatgctgaacctg
gagagggtcatgtggtcatcatcatgtgacatgcttgagaagataagtcagtatgaggct
gtccatcctgtaagaaactggacagacatcaagcatcgagtagggccgtacaggaggtgt
tttgtttttacacacagcagcatgcctaacgaaccgctcgtcatcttacacaccgccctc
acaagagatatttcagccagtattcagtccatagttcgtaagcagaatgacatagcagtt
ggtgtcaaatcaggagaagagaatcccgaggaggcccaggccgctatcttctactctatt
acatcaactcagaaaggtcttcagggtgtagagcttgggaaccatctcataaagagtgtc
gtcaaggagttacagtctgagttccccagcatgcatctcttctccagcctttctccgatc
cctggtttcagggactggctcatttcacagatcaacaagcaggtcaaagatgaacataac
accagcttattcacttctcaggagctagactcgttcaagtctgcgttaaacatcacatca
ttacaggcgctgtcaaccctgaagaaagtcattgtgacgaatgagtgggtcaagtcagaa
agcctggtcaagagtctacagtctcctctcatgaggttatgtgcaaggtatctgtatgta
gagaagagacgtaaaatggcactaaaccctgttgctaactttcaatcttcggaatggagc
caaccatgtggcgcttga

DBGET integrated database retrieval system