KEGG   Strongylocentrotus purpuratus (purple sea urchin): 754104Help
Entry
754104            CDS       T01019                                 

Definition
uncharacterized LOC754104
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     754104
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   754104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1340 aa AA seqDB search
MTIDDTLRRDLFKSKAKSGDREGSGTKAYDIDLDKHLVSSSKQVLLKHVDFQAAQKDISF
RLQNLRGKYVPLNAAKSNLQGEGSKKSQGYSHKGKMSLQDESQSKSDGIPAPKQVLYKPE
RVRLDWQKCNRVGSGLINMGNTCFLNSTLQCLTYTAPLANYLLSHQHKEECRSYGFCILC
DLYTHIQRAFQHPNQAIRPMNMIHKLKSIAKHMHIGRQEDAHEFLRYVIEAMQKSCLSGY
DNKLDRYSKETSPVHQIFGGYYRSRVICAACQSKSDTFDPFLDISLDIKHAPSVHKALNR
LIQSEMLDGDNAYQCKRCNRKVLAQKRFTIHRCPNILTLCLKRFEFNRFSMGKINKEVSY
SEYLNLRPFMSETKGPAVGYQLYAVLKHEGGSCNSGHYYCYVRAPNQSWYCMNDSYVSQC
SLNRVLNQNAYVLFYIRKPPKPNVNGNNQMQAQQTNKQMPKTATSPGITHKASNPHQGPV
GTPIARPKPTPPRPTTPTSSHTPLTPKPKIIREPEKKPQTFTPMAKHNLPQMIAPPGKRD
KLSFVIKSKGIASTLLSLKQGQGSVKQGPGSVKQAQGSVSAETKGNPLLDKGGASGPPRS
DSSSISGKSPLKAKNNGDVAVATKKHKAPGLLKSKEEEKPTESPKKATVVKKTTVMTKTT
VMTKATVVTKVKKRSSLVPYDNDDDSSSSSDSDTNYDAVVERLSKGAVKDTGASSSNGSK
EVVKGDPDMKPPDAAALEREREKRSALASSINLTAIRKTDSPLKLTITTNGNAQRIMSTT
PWKVTDGDEQVSPSVTSDSSNHSNQSSNSTREWAVNDKKDKQSVEEAVKKEASHVGWSVK
PSPSRNGVGKFRPDNGEDRRTGSPTKPTPCKTKKDVTAGNGLKNRTPSFSEKSFVSKREK
LGIVPKQLNGKHVNQDRTKLSVPDTQTDVQGSSGVGKEREKSNGKSFLVHQQSAITKHGV
DAQSSNGKKNGSDFKKDTASSSDDSDSEEEEEVGKNNKSRSEVTLKKNKKKKTKKFVSDA
EPPATSEANGQSDRKDTSEKGTGVGKSEKLPESDAFRKYRGTGNDSDSDHGSNAAFKRKK
NGQPASGLHHQKFPPAPQRFHQERFSSPTDSDYDEDSPVGPHNQGPRRKREYPGGGQGYY
EERPHPPQQQGQAHWYGAPLGNKRKKMVNGYDDGYGKQDQRRFRQEGPHQHWDHHIQQGG
YPQRPGGDGPPHKMSQSWDGTRRPPPGEVMDFLNKSSHKGYGPSVQSWDGGRSGIDEEVA
RDHANMKRRSTWNDDYDMGKVKKMRKPFNPQDQLPGHHNSFQHVQNHRNKGSFHGQHRGG
FNQHHIKKSRSWHGGNRRMR
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atgacgatagacgacactctgcggcgagaccttttcaagtctaaggccaagtctggtgat
cgagaagggagcgggacaaaggcttatgacattgacttggacaagcacctggtgtcttct
tcgaaacaggtactattgaagcatgtagatttccaggcagcacagaaagacatttcgttt
cgtctccagaatctgcgagggaaatatgtcccattgaatgcagccaagtcaaacttacag
ggtgaaggctctaagaagtcccaaggatattcacacaaaggcaagatgagccttcaggat
gagagccaaagcaagtcggatggcatcccggcccccaagcaggtgctctacaagccggag
agggtgcggctggactggcagaagtgtaaccgagtcggcagcggcctcatcaacatgggc
aacacctgcttcctcaactccaccctgcagtgcctgacctacacagcccctctggcgaac
tacctgctcagccatcaacacaaggaggagtgtcgatcatatggtttctgcatcctgtgt
gacctctacacacacatccagcgtgccttccagcatccaaaccaagccattagacccatg
aacatgatacacaaactcaaaagtatagccaagcacatgcatataggacggcaggaagac
gcacacgagttcctacgctatgtcatagaagcaatgcagaagtcctgtcttagtggatat
gataataaactggataggtacagcaaggaaaccagtcctgtacatcagatattcggaggc
tactacagaagcagagtgatatgtgcagcatgtcagagtaaatcagacacctttgaccct
ttcttggacatcagtctggacatcaagcatgctccttctgttcacaaagccttgaataga
cttatacaatctgaaatgctagatggggataatgcgtaccaatgcaaaaggtgcaacaga
aaagtgctagcacagaagaggttcacgatacaccgatgtcccaatatactcacactttgc
ctgaagaggtttgagttcaaccgcttcagcatgggtaagatcaacaaggaagtgagctac
tcagaatacctcaatcttcggccgttcatgagtgaaaccaaaggtcctgccgtcggctac
cagctctacgccgtcctgaagcatgagggtggctcctgcaactctggccattactactgc
tacgtgcgcgcccccaaccagtcctggtactgcatgaatgactcctacgtcagtcagtgc
agtctgaacagggtgctcaaccagaatgcctacgtcctcttctacatcaggaaacctccc
aagcccaatgtcaatgggaacaatcagatgcaggcacagcagaccaacaaacaaatgcca
aagacagccacctcacctggcatcacccacaaggcttctaaccctcatcagggtccagtt
ggcacacctattgccagacccaagcctacccctcccaggcccactacaccaacgtcatcg
cacacaccacttactcctaagccaaagatcatccgagagccagaaaagaagccgcagaca
ttcaccccaatggccaagcacaacctgcctcagatgatcgcaccacctgggaagagagac
aagttgtccttcgtgatcaagagcaaaggtatcgcaagcactctgctgagtttgaagcag
ggacaaggtagcgtgaagcagggaccaggtagcgtgaagcaggcacaaggtagcgtgagt
gcggagaccaaaggcaatccactcctggacaaaggtggtgcctcaggtccgcctcgaagt
gattcatcaagcatctctgggaaatcgccactcaaggcaaagaataatggggacgttgct
gttgcaacaaagaaacataaagctcccggattgctgaagtcgaaggaagaggagaaacca
accgagtcgccgaagaaggcaacagtggtgaagaagacaacagtgatgacaaagacaaca
gtgatgacaaaggcaacagtagtgacaaaggtcaagaagcgctcgtctctagtgccatat
gacaatgatgatgactcgagttcctcaagtgactctgacacaaactatgatgccgttgta
gaacgtttgagcaagggtgcagtgaaagatactggtgcctcatccagtaatggtagcaaa
gaggtggtgaaaggggatccggacatgaaaccccccgatgcagctgctttagagagagag
agagaaaagaggtctgctcttgctagcagcataaacttgactgccatccgcaagacagac
tcacctctcaaattgacaatcaccacaaatggaaatgcccagcgcattatgagcacaaca
ccatggaaagttacagatggtgatgaacaggtttcaccgtcagtcacatcagatagcagc
aaccacagcaatcaatcctccaactctaccagggagtgggctgtgaatgacaagaaggat
aagcaatcagttgaagaggcagttaagaaagaggcctctcatgttggttggagcgtcaag
ccttccccctcccgcaatggtgtgggtaagttcaggcctgataatggagaggacagaagg
actggctcccccacaaagccaaccccttgcaaaacaaagaaagacgtgactgcagggaac
ggtttgaaaaacagaactccctccttttctgaaaaatcttttgtgagcaaaagagaaaaa
cttggtattgttcccaagcagttgaatggcaagcatgtgaaccaagacaggactaagctg
agtgtgcctgacacccagacagatgtgcaaggtagctctggtgttgggaaggaaagggaa
aaatccaatggtaaatcatttcttgtacatcaacagtcggccatcacaaaacatggggtt
gatgcccaaagctccaatggcaaaaaaaatggttcagattttaagaaagacactgctagc
tcaagtgatgatagtgatagcgaggaggaggaggaggtcgggaaaaacaataaatcacgg
tcagaagtcaccctcaagaagaataagaagaagaaaacgaagaagtttgttagtgatgca
gaaccaccagcgaccagtgaagcaaatggacagagtgataggaaggatacgagtgagaaa
ggaacgggcgtcggtaagagtgagaaattaccagagagtgacgcattccggaaatatcgt
gggacgggtaacgactcggacagcgatcacgggagcaatgctgctttcaagaggaagaag
aacggacagccagcctccggtctgcaccatcagaagttcccaccagctccacagcgcttt
catcaagagagattcagctcaccgacggacagcgattatgacgaggattctccagtgggg
cctcacaatcaggggccacggaggaagcgggagtatcccggcggcgggcagggctattac
gaggaaaggccgcaccccccacaacagcagggacaggcccactggtacggcgcacccctg
gggaacaagaggaagaagatggtgaatggatatgatgatggctacgggaagcaggaccaa
aggagattcagacaagaaggtccccaccagcactgggaccaccacattcagcagggtgga
tatccacagcgaccgggtggagatggcccccctcataagatgagccagtcttgggatggg
accaggagacctcctccgggagaggtgatggacttcctcaacaaatcctctcacaaagga
tacggaccatcggtgcaaagttgggatggtggacggagcggcatcgatgaggaggttgct
agagaccatgccaacatgaagaggaggagtacatggaacgatgattacgatatggggaag
gtgaagaagatgaggaaaccattcaacccacaagatcagctccctggccatcataattcc
ttccagcatgtacagaaccatcgcaataagggcagctttcatgggcagcatcgcggagga
tttaaccagcatcatatcaagaaatcacggagttggcatggcggcaaccgaagaatgagg
tga

DBGET integrated database retrieval system