KEGG   Strongylocentrotus purpuratus (purple sea urchin): 754151Help
Entry
754151            CDS       T01019                                 

Definition
josephin-2-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     754151
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C86
   754151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 160 aa AA seqDB search
MPIYHEKQRWELCALHALNNVFQDGKAFNKQSMDELCQSLSPGSVLNPHKSMLGLGXXXX
SLEQLELDNILGFIMNVPSPIQLGFVSVPIRRKHWIALRHIEGAFYNLDSKLSKPQTIGT
TSAIFLDFLRSQLKQKGCELLLIVERDVCELRTWLKDPTS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgccgatctaccatgagaagcagcgctgggagctgtgcgctcttcatgcactcaataac
gtgttccaggatgggaaagctttcaataaacaatccatggatgaactatgccaaagctta
tcgcccggctcggtactgaacccacacaagagcatgctgggattgggtnnnnnnnnnnng
agtctggaacaacttgaactggacaacatcctgggtttcatcatgaacgtaccctcgccc
atccagctgggcttcgtcagcgtccccatccgtcgcaaacactggatagccctccgccat
atagagggcgctttttacaatctagactccaaactgagcaagccgcagacaatcggcact
acctccgcaatattcctggactttctacgctctcagctcaagcagaaaggctgtgaactc
ttgttgattgtagagcgggatgtttgtgaactgcgtacgtggttaaaagacccgacgtct
tga

DBGET integrated database retrieval system