KEGG   Strongylocentrotus purpuratus (purple sea urchin): 754280Help
Entry
754280            CDS       T01019                                 

Definition
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:spu00562]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:spu04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:spu04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:spu04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:spu04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 536 aa AA seqDB search
VWGCEEYLINDDYPVSQNTYIRQCILKSKIPELMLMSKDTVLNSLPDVHLLLPSYMRRAS
TMPSDRTTSCVWEVEENLRVKINFATYVNVKELDKIYVRTGIYHGEEPLCPIVSTEQVPW
SNPRWNEWLTYDIKVNDIPRSARWCVSICSSEKRKGKKEGGFAIPWGNINLFDFTTRLQM
ANMRLYLWPPPKGNDDLLNPFGQTGPNPNKDAPCLELEFYRYPHSLLFPCYSQIQQFAFF
VTKAQRREEINGEKPPTEEELVLLEEILNRDRLHEMSVQEKELVWKLRLVCREYPYSLPK
LLSSVKWYSREDVSQLYVLLKDWPDMDAETALGLLDCSYADLGVRTEAVNCLDRMSDEQV
TQYLLQLVQVLKYESYLDNPLARFLLKRSLYNQRIGHFFFWHLRSEMHKPSVSRRFGLML
EAYCRSLGPYLKLLVRQVEALDKLSKLTEMLNEKKDDTNRVRLKYLAEHMAQPDFIEALQ
ELPLPLNPSFSLGKLRVDKCKIMSSAKRPLWLEWENPDQMSMSMCEDLKIIFKRGD
NT seq 1609 nt NT seq  +upstreamnt  +downstreamnt
gtttgggggtgtgaggaataccttataaatgatgattatcctgtctcacagaacacgtat
atccggcagtgtatcctgaagagcaagattccagagctgatgctgatgtccaaagacacc
gtcctcaacagtctcccggacgtccacctcctactaccgtcctacatgagacgggcttcc
accatgccttccgaccggaccacctcctgcgtctgggaggtagaggagaacctgagagtc
aagatcaactttgccacctacgtcaacgtcaaggaactagacaagatatacgtccgaaca
ggcatctaccacggggaagagcctctgtgccccatcgtgtctacggagcaggtcccgtgg
tcaaaccctcgctggaacgagtggttgacctatgacatcaaggtcaatgacattcctcgt
agcgctaggtggtgcgtctcgatatgctcatcggagaagaggaaaggaaagaaagagggt
ggctttgcaataccctggggcaacatcaacctctttgacttcaccacccggcttcagatg
gccaacatgcgcctctacctctggcccccgcccaagggcaacgacgacctcctcaacccc
ttcggccagactggaccaaaccccaacaaggacgccccgtgcctggaactggagttctac
cgctaccctcacagtctgctcttcccgtgctactcccagatccagcagtttgcctttttc
gtgaccaaagcgcagaggagggaagagataaacggggagaaacctcctacggaagaggag
ctcgtgctactggaggaaatcttgaacagggacagactgcatgagatgtctgtgcaggag
aaagaacttgtctggaaactcagacttgtatgcagagaatatccatactcgctaccaaag
ctgcttagctctgtcaaatggtacagcagagaggatgtatcacagctgtacgttctcttg
aaggactggccagacatggacgccgagactgctctaggtctcctagactgtagctatgct
gatctgggtgtcaggacagaagcagtcaactgcctagatcgtatgtcggatgaacaggtc
acacaatacttacttcaacttgtacaggttttgaagtacgagtcctacctagacaaccct
cttgccaggtttcttctcaaacgatctctgtacaaccaaaggattggacacttcttcttc
tggcatctaagatctgagatgcacaagccgagcgtgagcagacgttttggtctgatgctt
gaagcgtactgccggtcactcggtccatacctcaagctgctggtcagacaggtggaggct
ctggacaaactctccaagcttaccgaaatgctcaatgagaagaaggacgacacaaacagg
gtccggttaaaatacctagcagagcacatggcacagccggacttcatcgaagctctccag
gagcttcccttacccctgaacccctccttctccttgggcaagctcagagtcgacaagtgc
aagatcatgtcgtctgcaaagcgccctctatggctagaatgggagaacccggatcagatg
tcaatgtccatgtgtgaagatctcaagattatcttcaagaggggtgatg

DBGET integrated database retrieval system