KEGG   Strongylocentrotus purpuratus (purple sea urchin): 754280Help
Entry
754280            CDS       T01019                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Insulin resistance
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    754280
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    754280
   04068 FoxO signaling pathway
    754280
   04070 Phosphatidylinositol signaling system
    754280
   04150 mTOR signaling pathway
    754280
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    754280
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     754280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 503 aa AA seqDB search
MLMSKDTVLNSLPDVHLLLPSYMRRASTMPSDRTTSCVWEVEENLRVKINFATYVNVKEL
DKIYVRTGIYHGEEPLCPIVSTEQVPWSNPRWNEWLTYDIKVNDIPRSARWCVSICSSEK
RKGKKEGGFAIPWGNINLFDFTTRLQMANMRLYLWPPPKGNDDLLNPFGQTGPNPNKDAP
CLELEFYRYPHSLLFPCYSQIQQFAFFVTKAQRREEINGEKPPTEEELVLLEEILNRDRL
HEMSVQEKELVWKLRLVCREYPYSLPKLLSSVKWYSREDVSQLYVLLKDWPDMDAETALG
LLDCSYADLGVRTEAVNCLDRMSDEQVTQYLLQLVQVLKYESYLDNPLARFLLKRSLYNQ
RIGHFFFWHLRSEMHKPSVSRRFGLMLEAYCRSLGPYLKLLVRQVEALDKLSKLTEMLNE
KKDDTNRDRLKYLAEHMAQPDFIEALQELPLPLNPSFSLGKLRVDKCKIMSSAKRPLWLE
WENPDQMSMSMCEDLKIIFKRGD
NT seq 1510 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgtccaaagacaccgtcctcaacagtctcccggacgtccacctcctactaccg
tcctacatgagacgggcttccaccatgccttccgaccggaccacctcctgcgtctgggag
gtagaggagaacctgagagtcaagatcaactttgccacctacgtcaacgtcaaggaacta
gacaagatatacgtccgaacaggcatctaccacggggaagagcctctgtgccccatcgtg
tctacggagcaggtcccgtggtcaaaccctcgctggaacgagtggttgacctatgacatc
aaggtcaatgacattcctcgtagcgctaggtggtgcgtctcgatatgctcatcggagaag
aggaaaggaaagaaagagggtggctttgcaataccctggggcaacatcaacctctttgac
ttcaccacccggcttcagatggccaacatgcgcctctacctctggcccccgcccaagggc
aacgacgacctcctcaaccccttcggccagactggaccaaaccccaacaaggacgccccg
tgcctggaactggagttctaccgctaccctcacagtctgctcttcccgtgctactcccag
atccagcagtttgcctttttcgtgaccaaagcgcagaggagggaagagataaacggggag
aaacctcctacggaagaggagctcgtgctactggaggaaatcttgaacagggacagactg
catgagatgtctgtgcaggagaaagaacttgtctggaaactcagacttgtatgcagagaa
tatccatactcgctaccaaagctgcttagctctgtcaaatggtacagcagagaggatgta
tcacagctgtacgttctcttgaaggactggccagacatggacgccgagactgctctaggt
ctcctagactgtagctatgctgatctgggtgtcaggacagaagcagtcaactgcctagat
cgtatgtcggatgaacaggtcacacaatacttacttcaacttgtacaggttttgaagtac
gagtcctacctagacaaccctcttgccaggtttcttctcaaacgatctctgtacaaccaa
aggattggacacttcttcttctggcatctaagatctgagatgcacaagccgagcgtgagc
agacgttttggtctgatgcttgaagcgtactgccggtcactcggtccatacctcaagctg
ctggtcagacaggtggaggctctggacaaactctccaagcttaccgaaatgctcaatgag
aagaaggacgacacaaacagggaccggttaaaatacctagcagagcacatggcacagccg
gacttcatcgaagctctccaggagcttcccttacccctgaacccctccttctccttgggc
aagctcagagtcgacaagtgcaagatcatgtcgtctgcaaagcgccctctatggctagaa
tgggagaacccggatcagatgtcaatgtccatgtgtgaagatctcaagattatcttcaag
aggggtgatg

DBGET integrated database retrieval system