KEGG   Strongylocentrotus purpuratus (purple sea urchin): 754280Help
Entry
754280            CDS       T01019                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
Autophagy - animal
mTOR signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    754280
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    754280
   04070 Phosphatidylinositol signaling system
    754280
   04150 mTOR signaling pathway
    754280
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    754280
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    754280
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     754280
Membrane trafficking [BR:spu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    754280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 503 aa AA seqDB search
MLMSKDTVLNSLPDVHLLLPSYMRRASTMPSDRTTSCVWEVEENLRVKINFATYVNVKEL
DKIYVRTGIYHGEEPLCPIVSTEQVPWSNPRWNEWLTYDIKVNDIPRSARWCVSICSSEK
RKGKKEGGFAIPWGNINLFDFTTRLQMANMRLYLWPPPKGNDDLLNPFGQTGPNPNKDAP
CLELEFYRYPHSLLFPCYSQIQQFAFFVTKAQRREEINGEKPPTEEELVLLEEILNRDRL
HEMSVQEKELVWKLRLVCREYPYSLPKLLSSVKWYSREDVSQLYVLLKDWPDMDAETALG
LLDCSYADLGVRTEAVNCLDRMSDEQVTQYLLQLVQVLKYESYLDNPLARFLLKRSLYNQ
RIGHFFFWHLRSEMHKPSVSRRFGLMLEAYCRSLGPYLKLLVRQVEALDKLSKLTEMLNE
KKDDTNRDRLKYLAEHMAQPDFIEALQELPLPLNPSFSLGKLRVDKCKIMSSAKRPLWLE
WENPDQMSMSMCEDLKIIFKRGD
NT seq 1510 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgtccaaagacaccgtcctcaacagtctcccggacgtccacctcctactaccg
tcctacatgagacgggcttccaccatgccttccgaccggaccacctcctgcgtctgggag
gtagaggagaacctgagagtcaagatcaactttgccacctacgtcaacgtcaaggaacta
gacaagatatacgtccgaacaggcatctaccacggggaagagcctctgtgccccatcgtg
tctacggagcaggtcccgtggtcaaaccctcgctggaacgagtggttgacctatgacatc
aaggtcaatgacattcctcgtagcgctaggtggtgcgtctcgatatgctcatcggagaag
aggaaaggaaagaaagagggtggctttgcaataccctggggcaacatcaacctctttgac
ttcaccacccggcttcagatggccaacatgcgcctctacctctggcccccgcccaagggc
aacgacgacctcctcaaccccttcggccagactggaccaaaccccaacaaggacgccccg
tgcctggaactggagttctaccgctaccctcacagtctgctcttcccgtgctactcccag
atccagcagtttgcctttttcgtgaccaaagcgcagaggagggaagagataaacggggag
aaacctcctacggaagaggagctcgtgctactggaggaaatcttgaacagggacagactg
catgagatgtctgtgcaggagaaagaacttgtctggaaactcagacttgtatgcagagaa
tatccatactcgctaccaaagctgcttagctctgtcaaatggtacagcagagaggatgta
tcacagctgtacgttctcttgaaggactggccagacatggacgccgagactgctctaggt
ctcctagactgtagctatgctgatctgggtgtcaggacagaagcagtcaactgcctagat
cgtatgtcggatgaacaggtcacacaatacttacttcaacttgtacaggttttgaagtac
gagtcctacctagacaaccctcttgccaggtttcttctcaaacgatctctgtacaaccaa
aggattggacacttcttcttctggcatctaagatctgagatgcacaagccgagcgtgagc
agacgttttggtctgatgcttgaagcgtactgccggtcactcggtccatacctcaagctg
ctggtcagacaggtggaggctctggacaaactctccaagcttaccgaaatgctcaatgag
aagaaggacgacacaaacagggaccggttaaaatacctagcagagcacatggcacagccg
gacttcatcgaagctctccaggagcttcccttacccctgaacccctccttctccttgggc
aagctcagagtcgacaagtgcaagatcatgtcgtctgcaaagcgccctctatggctagaa
tgggagaacccggatcagatgtcaatgtccatgtgtgaagatctcaagattatcttcaag
aggggtgatg

DBGET integrated database retrieval system