KEGG   Strongylocentrotus purpuratus (purple sea urchin): 754846Help
Entry
754846            CDS       T01019                                 

Definition
histone H2B, embryonic-like
Orthology
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   754846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 92 aa AA seqDB search
GGKKRNRKRKESYGIYIYKVLKQVHPDTGISSRAMVIMNSFVNDIFERIAGESSRLAQYN
KKSTISIRWLFLFLPPLGRGALTAFLEPFLAT
NT seq 280 nt NT seq  +upstreamnt  +downstreamnt
cggtggcaagaagaggaacaggaaaaggaaggagagttatggaatctacatctacaaagt
cctcaagcaggttcatccagataccggcatctccagtcgggccatggtcatcatgaacag
cttcgtcaacgacatcttcgagcgaattgccggcgaatcttcccgcctcgctcagtacaa
caaaaagtcaaccatcagcattcgatggttattcctcttcttgccaccgctgggccgagg
ggccttgactgccttcttggagcctttcttagcaacttga

DBGET integrated database retrieval system