KEGG   Strongylocentrotus purpuratus (purple sea urchin): 756837Help
Entry
756837            CDS       T01019                                 

Definition
general transcription factor 3C polypeptide 4-like
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 630 aa AA seqDB search
MPIIGSKTPKSDINEIFVISSFQEQTFNPSFRFDFLNFSKEIVKDTKEDHQFYDVGVETA
EIKKLPKGSYIQQRFALNGLLLEGDAVSPYSEQFKTVKFSPVSDYQERSLLATLSRDNRV
VVYCTGKGQGFIKVENLSDKLYEYAKKTNFTLSSDGEEEKEVATNKETSTDFVECQRRTN
SVSVTGIAWSGVLTSSVKKPLPTRGKSNAKRKRPDNDAETSTNDFILLATALKSNHVVLW
KFPCPVNEKSTSQLAAVIRPDDRTSAMHWCVREKNEKAYLATGGCDGRISVWSVSPEGDV
TGHRELDVWKETDDILVQALTWVQALCTGDSFVLLAAKGPCVFVFQIHLMNGNMEIAHQS
HTLTKHSALVSGMCNIRDKVYTSSVDGSIQVAQVKQDNGISVDLHLLERPKYMTTRINGM
SASTNGVYLTTVNRHSSYATHIEKSNLKFLQIATDQEAEQMLMEPQGRLCFKFDCLDWLY
QRLTPEGALQNTTVTILSDDALADKSPSEILYLLKLRRLVVMMIAHRISCEINNSRGRKR
DTLEVMIKINEGHVKEISDRIFQLHIEKSLETLASADTRKKVTGRAKRVQKLMSDWLVLN
ESRSKAPITESGSVDGDACESCRLCGENIL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgccgataatcggctccaaaacacccaagtctgacataaatgaaatatttgtaatctct
tctttccaggagcaaacctttaacccctctttcagatttgactttctgaacttctccaag
gaaatagtgaaggatacgaaagaggatcatcagttttatgatgttggagtcgagactgca
gagatcaagaaacttcctaaaggatcatatatccagcagcggttcgctttgaatggatta
ttgttggaaggagatgcagtatctccttattcagaacaattcaaaactgtcaagttctct
ccagtgtctgattaccaagagaggagcctcttggcaacattatcacgtgataacagggtt
gtagtctactgcactggaaaaggacaaggtttcattaaggtggaaaatctatcagataaa
ttgtatgagtacgccaagaagacgaacttcaccctgagctcagatggggaggaggaaaag
gaagtagcgacaaacaaggaaacaagcactgactttgtggaatgtcagagaagaacaaac
tctgtgagcgttactggtatagcgtggtctggagtgctcacttcatccgttaagaagccc
ctaccaacaagaggcaagagcaatgccaagaggaagcgcccggacaacgatgctgaaacc
tcaaccaacgatttcattctcctggcaacagccctcaaaagcaaccatgttgtcctgtgg
aagttcccctgccctgtcaatgagaaaagcacttctcagttagctgcagtcatccgtcct
gatgatcgtacgtcagccatgcattggtgtgttagggagaaaaatgaaaaagcttaccta
gcaactggtggatgcgatggtaggatatcagtgtggagcgtttcgccggagggagacgtg
actggacatagagaacttgatgtatggaaggagacggacgatatactagttcaagcattg
acttgggttcaggcactttgtactggtgactcatttgtgctccttgctgccaaaggccca
tgtgtgtttgtcttccagatacacctgatgaatgggaacatggaaattgcacaccagtct
catactttgacaaagcattctgctctggtttcaggtatgtgtaacatcagagataaagtg
tatacttcttcggttgatggcagcatacaggtcgctcaggtcaagcaagacaatggtatc
tcggtagatcttcatttgctggaacgccctaaatatatgacaacgagaataaatgggatg
tcagcatcaaccaatggtgtctacctcacaactgtcaataggcactccagctatgcgaca
catatagagaaatccaatctgaaattccttcagatagcgacggatcaagaggcagagcag
atgctgatggaacctcaaggcaggctatgctttaagtttgactgccttgactggctctac
caaaggttgactccagagggcgctcttcaaaataccaccgtaaccatcctctccgacgat
gcgttggccgacaagtccccgagcgagattctgtacctgttgaagctgagacgccttgtc
gtgatgatgatagcgcacaggatatcctgtgagatcaacaactcacgagggagaaagaga
gataccctcgaagttatgattaagataaatgaaggtcatgtgaaggaaatctcagatcgt
attttccagctgcatatagagaaaagcttggaaacgctggcatcagctgacacgaggaaa
aaagtcacagggagagccaaacgtgttcagaagctaatgtctgattggctggtgctaaat
gaatcacgttctaaagcaccaatcacagaaagtggctcagtggatggggatgcgtgtgag
agttgcagattgtgtggagagaatatcctttga

DBGET integrated database retrieval system