KEGG   Strongylocentrotus purpuratus (purple sea urchin): 756938Help
Entry
756938            CDS       T01019                                 

Definition
28S ribosomal protein S18b, mitochondrial-like
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Ribosome [BR:spu03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    756938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 113 aa AA seqDB search
MGVEETRKRCIRGNGEKQQICGNPCPICRDSNLVLHYKNIKLLEQFICPHSWNIYSTYRT
GLCRRQHKALCATIEKARQYGVLPFSVPYIEYKYEDYYQDETSPKDKKRSVDI
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgggggtggaggaaacaaggaagaggtgcattagaggtaatggagagaagcagcaaatt
tgtggtaacccatgtccaatctgcagagattctaatctagtccttcattacaagaatata
aagctgttggaacaattcatctgtccgcattcatggaatatctactcaacgtacaggaca
gggttatgtcggaggcaacacaaggctctgtgtgcaaccattgagaaggcaaggcaatat
ggagtgttacccttttctgtaccctacattgaatacaaatatgaggattactatcaagat
gaaacttcaccaaaggataaaaagagatcagtcgacatttga

DBGET integrated database retrieval system