KEGG   Strongylocentrotus purpuratus (purple sea urchin): 762636Help
Entry
762636            CDS       T01019                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     762636
Transfer RNA biogenesis [BR:spu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    762636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 713 aa AA seqDB search
MGKTRKKSNLSHAEMMMMTVSDIVSQLVTAHDQNKDVNLNRIKSLTAKKYGLTNQPRLVD
IIAAVPHAHKKIAVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSM
RAIRARYNPYLQTRHRVDQLKQIGHSVDKVEFIVMGGTFMALSEEYRDYFIRNLHDALSG
HTSNSVEEAVKFSERSRTKCIGITIETRPDYCLKRHLSDMLKYGCTRLEIGVQSVYEDVA
RDTNRGHTVRAVCESFQMSKDAGFKVVSHMMPDLPNVDLERDVEQFIEFFENPAFRPDGL
KLYPTLVIRGTGLYELWKTGRYKSYPPSTLVDLVAKILALVPPWTRVYRVQRDIPMPLVS
SGVEHGNLRELALARMRDLGTQCRDVRTREVGIQEIHHKVKPYEVRLHSILCHKNCVEGL
DEHTVKGYVIHDLKSGAQVVVPYPKDKDSGSPITGRSFHHGRFIMGLRKAALAEERVSYI
EGSASKILEENGRVTGVSYKLKGTQDLKEMKAALTIIADGCFSKFRKQLTTTLPQTTSHF
VGTLMHHCPQYEAHHAELVLADPSPVLIYQISSEDTRVLVDVRGDMPKDVKQYMMDKVFP
QLPEHIKEPFADAIQNGRIRSMPNSFLPPAPVEKQGALLLGDAYNMRHPLTGGGMSVALN
DGFGMLLMEEAERIAREEHGSGKISVISGVGTRNYYRKLGYELDGPYMSKSLE
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaccaggaagaaatcaaacttgtcccatgctgagatgatgatgatgactgta
tcagatatagtcagtcagcttgtcactgcgcatgatcaaaacaaagatgtcaatctcaac
agaatcaagagtttgactgctaagaagtatggtttgacaaatcaaccgaggctggttgat
atcattgcagctgtaccccatgctcacaagaagatagctgttgtagcagtgatgtgtaag
ccccatagatgtcctcatattagtatgactggtaacatctgtgtgtactgtcctggaggg
cccgattctgattttgaatattcaactcagtcatacacaggatatgagccaacatcgatg
cgtgctatacgtgcccgatacaacccctacctgcaaaccagacatagagtagaccagtta
aagcagattggacacagtgttgataaggtggaattcattgtcatgggcgggaccttcatg
gcactgtccgaggagtaccgggactattttatccgcaatctgcacgacgccctctctggc
catacaagcaacagtgtggaagaggcagtcaagttttctgagaggagtaggaccaagtgt
attggtatcaccatagagaccagaccagactattgccttaagagacatctgagtgacatg
ttgaagtatggttgtaccaggcttgagatcggtgtgcagagtgtgtatgaagacgtagct
agagacacaaacaggggtcacactgtaagggctgtctgtgagtcctttcagatgtccaag
gacgctggtttcaaggtcgtttctcatatgatgcctgaccttcctaacgttgaccttgag
agagacgttgagcagtttatcgaattttttgagaacccagccttccgaccggatggtctg
aagctctacccgaccctagtcatcagaggaacaggtctttatgaactctggaagactggc
cgctacaagagctatcctccaagcaccctggtggatctggttgctaagatactggccttg
gtgccaccttggaccagggtctacagggttcaaagggatatcccgatgcctttggtcagt
tctggagtggagcatggtaacctgagagagttagccctagctaggatgagagacctaggt
acacagtgtagagacgtgagaaccagggaggttggcattcaagaaatacatcacaaggtc
aagccatatgaggtaagacttcattcgatcctctgtcataaaaattgtgtagaaggcctt
gatgagcacacggtcaaaggttacgtcatccatgacctcaagtccggagcccaggttgta
gttccttatcccaaggacaaggattcagggtctccaatcaccggcagatcattccatcat
ggcaggtttatcatgggtcttcgtaaggcagctctagctgaagaaagggtatcatacatt
gaaggcagcgcatctaaaattttggaggagaatggtagagtcactggagtgtcatataaa
ctcaaaggaacccaagacctcaaggagatgaaagctgccctcaccatcatcgctgatggc
tgcttctctaagttccgcaagcagctcaccaccaccctcccccagacgacctcccacttt
gtaggaaccctgatgcaccactgcccccagtacgaggctcaccacgccgagctggtcctg
gccgatccctctcctgtactcatctaccagatctcttcggaggatacaagggtactggtc
gatgtgagaggggacatgcccaaagatgtcaagcagtatatgatggacaaggtctttcca
cagttaccagaacacatcaaggagccctttgcagatgctattcaaaatggtcgcatccgc
agcatgccaaacagctttttaccacctgcaccagtagagaagcaaggtgctctgctgctg
ggtgatgcatacaacatgagacatccgctgacgggaggtggcatgagtgtggcgctcaat
gacggctttggaatgctactaatggaggaggctgagaggatagcacgggaggagcatgga
tcaggaaagatctctgtcatatcaggagtcgggactaggaactactatcgcaagctgggc
tatgagctagatggcccctatatgtcaaagtctctggaatga

DBGET integrated database retrieval system