KEGG   Strongylocentrotus purpuratus (purple sea urchin): 762935Help
Entry
762935            CDS       T01019                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    762935
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     762935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 613 aa AA seqDB search
MIPDVFLIILLLVIGLASATDIPRDLKVNTNVGEVLGKRLTTVAVGAPNRQVDAFLGIPY
AEPPVDDLRFKAPVAKRPFDHTLNATYYGYGCFHFPDETFPGFRGSEMWNSPVRLSEDCL
NLNVWTPYPRPQAATVMIWIYGGSFLSGVSSLDVYDGQYLAAEQNVVVVSMNYRLGALGF
LAMGQDSSPGNQGLMDQTLAMRWVQDNIHEFGGDPNQVTIFGESAGAASVSLHLLSPISR
NLFQRAIMQSSAATAPWATVDHDEGLRRGKLLAEKLQCSEGNNGVELTIPQMVDCIRTRE
VTQILLKQFEITDGFCEFPFPPVVDGTFITETPRTSLERRSFKDGEIMLGSNLNEAYFFI
IYEVPGFDKDSESLLNRDQFYDALQYSFPRVNSFGQDAIAFQYTEWLAPHDPVKLRDGVD
FAAGDYLFACSTYDFAYSYASANNKVYYYRFLERDSTSPWPDWMGVLHGDEILYIFGMPL
IAERNYTDIEVALSRKMMTYWANFAKTGNPNKMTDSDPDSGEWPEYTTNKQKYLELTEDL
ANNNPSVGRGPKADKCAFWRDYLPTLQTQTGDIKETEIKWKEEFSKWYTKHMVNWKAEFA
HYINNKDAQCDGR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgattcctgacgtatttctcattattctattgctcgtgatcgggcttgcgtccgctacg
gacatccctcgtgaccttaaggtcaacaccaatgttggcgaggtcttagggaagagactc
acgaccgttgctgtcggtgctccgaacagacaggtggacgctttccttgggattccttac
gccgaaccacctgtggatgatctccgattcaaagctcccgtagccaagcgaccgtttgat
cacacattaaacgccacatactatggctacgggtgctttcatttccccgatgagactttc
cccggtttcaggggatcggagatgtggaactcaccagttagattaagtgaggactgttta
aatttgaatgtgtggacgccttacccaaggccgcaggcagccactgtcatgatctggatt
tatggtggtagctttctgtctggtgtttcttcgttagacgtgtacgatggtcaataccta
gctgctgagcagaatgtggtggttgtgtccatgaactaccgcttgggagctttgggattc
ttagcgatgggacaagacagttcacccgggaatcaaggtctaatggaccaaactctggcc
atgcggtgggtgcaggataacatccacgagtttggaggcgaccctaaccaagtgaccatc
ttcggagagagcgccggtgccgccagtgtatctctacacttgctgtccccaatcagtcgc
aatctttttcaacgagctatcatgcagagttctgctgccacggcgccttgggccaccgtc
gaccacgatgaggggttgaggagaggcaagctcttagcggagaaattacaatgcagtgaa
ggtaataatggcgttgagctaaccattccgcagatggtagactgtattagaacaagggag
gtcacccaaatcctcttgaagcagtttgaaatcacagatggcttctgcgagttccctttc
ccaccggtcgtagatggcacatttataacagaaaccccacggacatcgctagaaaggcga
tcctttaaggacggagaaatcatgttgggtagcaatttaaacgaggcatacttcttcatc
atatatgaagtaccaggcttcgacaaggacagcgagagcttgctcaacagagatcagttt
tacgacgctctgcagtactcctttccgagggtcaacagctttggtcaagatgccatcgct
ttccaatataccgagtggctggctcctcacgatcccgttaaactgcgagacggtgtggac
ttcgctgccggtgattacctcttcgcgtgctccacctacgacttcgcctactcctatgcc
tccgctaacaacaaggtttattactacagattcctcgagagggactccacaagcccctgg
ccagattggatgggggttcttcacggtgatgagattctttatatctttggaatgcctctg
atcgcagagcggaattacaccgatatcgaagtggcgcttagtcgaaaaatgatgacctac
tgggccaattttgccaaaactggaaacccaaacaagatgacggatagcgatccggattcc
ggtgaatggcccgagtacacgactaataagcaaaagtatctggaactgactgaagacctg
gcgaacaacaatccttcggtgggcagaggacccaaggctgacaaatgcgcattctggaga
gactatttaccaacgttacaaacacaaacaggagatatcaaagagacggaaataaagtgg
aaagaagagttcagtaaatggtacacaaaacacatggtgaattggaaggcagagtttgca
cactacatcaataacaaggatgcacaatgtgacgggcggtga

DBGET integrated database retrieval system