KEGG   Strongylocentrotus purpuratus (purple sea urchin): 763219Help
Entry
763219            CDS       T01019                                 

Definition
uncharacterized LOC763219
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    763219
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1215 aa AA seqDB search
MRVIIGIAASLLVILCLSLFVLPFTLTVFLILTIGSFIAFHLSQNPAGVSRALAHVQSLS
AAAPKFWPPRPEEEATTRRTTAKPSSPTYQPKLTDSIKERGKENINNFVRSTLKPRRFGN
VVESSEFHGKSPQQSQSWVPLKNSTAANFSTTWSPRPATDKSEGFNFSTGYNFDNKLSFS
RLPLSPIYTPNKSIDSPELDLSSTMLRFNSGQDSLLHPSMHYPTHQPDLVASPGLLPSVS
WLKDGGLSSPRHRRGLPRVQSPVMVKIASLFPDRPASPLFRKLASENDKQKASSADKVIM
AIKLRQKRTAQDANTESGSPIAPSDVRSESKRRKLESTYGKDVARSDIDMDLDPMPRRKH
TDRVFWPSRYGITSPTPRNPIVSSFSSSRKSQSTLKRRMDTSSIEVEEEEGVSPIKKKAH
PQASQQSPGLQSPSKRTSANQPRTPGFSSIRSGGRALYLEKNTGLPAAGSPCKEAGTTPQ
KSSLKGKLFTPKRTSFAPRVDTPGDYTAADNKEDRAQARQRGSYLKEMLMQETEEGTSKD
GDSTVSAPKTNALFTGAAVTTTTASNPLTTFSIGSLPKSTASTTSVAPSVLSSTATTSSG
GTPALGIPSTSVQKTSDNPLLSSSDKQKLTATSSEKTVKFGNPAAAQLNLSSSASAAASV
GTTPQKSGETALGFKLPSAPSIGNGLLKIQATLPSFTLGANPLGTSLSSALGGTQVDAKV
QSLSTNNNAVTTSRAGAGGLVKTTHPGTLSAPISGGFTASGAAAPIFGGFSTTAAPATST
LTTTSSIKTQFAPAFGGPGAASGVQSSAGTTPGKPSSQAQAGGFQFGQTLGGSTSIPAGG
LSFGNTKTSSVPGGLATPFQATAQTSAPASTVNKQMSSTPAPNTTAPSAKQGGGPQFPPI
FGQQAATKPAGANGPGQGGPSFGSNTSQPAAGGFTFGQSVSSATTAAAPPAFNFGGSTPT
PTSSTSSLFSSAPATPFGASKPASAVGSNLFGSTPAQNQTPLGGAPTNTSTMFGGAKATP
QKPAFGATNNTSMFGAGSTPGATSAPKPAFGNPTATLTPFGSSQSQLPPPAAASPFQFGS
SQPKAPTQPAATGGFNFGGQATPQKPVGFGASAPAPASNNGFQFGQTQPSSGAATQSNFF
GGSTANTASPFGGGGGGGFGTPAPSSGNTPAPAFGASPSPAGATGFSVGTGGTNPASNQR
RMNRLKQVRNRASRR
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgatcattggaatagcagcttcattattagtaattttatgtctttctctattt
gttttgccttttactttgactgtattccttattttaacgatcggttcattcattgctttt
cacttgtcacaaaatccggctggtgtctcgcgagctctggcccacgtgcagtctttgtcc
gcggctgccccgaagttctggccgcctagaccggaagaggaggccacaactcgtcggaca
acagccaaaccatcttcgccaacttatcaaccaaagcttacagacagcatcaaagagaga
ggaaaagaaaacatcaataattttgtgagatcaactctgaagccaagaaggtttgggaat
gttgtagagtcgagtgaatttcatggaaaaagtccacaacaaagccaaagttgggttcct
ctgaaaaattccactgctgcaaatttttcaacaacatggagtccacgaccagccactgac
aagtctgaaggattcaatttttctactggatacaattttgataataaactctcattctcg
agactcccattgtcacctatctacacccctaacaaatcaatagacagtcccgaattggat
ttgagctcgacgatgctacgcttcaactcgggccaggattctttgcttcatcctagcatg
cactacccaacccaccaacctgacctggtggcctcccccggtctgcttccttcggtcagc
tggctgaaagatggaggactgtccagtcctagacacaggagaggtctacccagggtacag
agtccagtcatggtcaagatcgccagtctattcccagaccgtccggccagtcctctgttt
agaaaactagcatcagagaatgataagcagaaagctagcagtgcagataaggtcattatg
gctatcaaactgaggcagaagagaacggcacaggacgctaatactgagtccggtagtcca
atagcgccctctgatgtcagaagtgaatcaaagaggagaaaattggaaagcacctatgga
aaagacgttgcaagaagtgatatcgatatggatttagatcctatgcctaggcgtaaacat
acggacagagtcttctggccttcaagatacggaatcacatcacccacacctagaaaccca
attgtcagctccttcagttcatctaggaaatcccagagtacattaaagagaagaatggat
acatcatcaatagaggtagaagaggaggagggtgtatcacccatcaagaagaaggcccat
cctcaggcatcccagcaatctcctggtctccagagcccctccaagaggacaagcgccaat
caaccaagaaccccaggattttcatcgattagatctggcggtagagccctctacctggag
aagaacactggactaccagcagcagggtcaccctgtaaggaagcaggaacaacgcctcag
aaatcgagtctgaaggggaaactgttcactcccaagaggacttcatttgctccgagagta
gacacaccaggtgactacactgctgctgataacaaggaagacagagctcaggcaaggcag
agaggaagttacctcaaagagatgctcatgcaggagacagaggaaggcacctcaaaagat
ggtgattctactgtctcagctccaaagacaaatgccttgtttacaggagcagcagtaaca
acgacaacagcctctaaccctctgacgacattctctataggatcccttcccaagtctacg
gcttccactacaagtgtagcaccttcggttctgtcttcaacggccactacgtcttctgga
ggaacccctgctcttggtattccctcgacatccgtacagaagacaagtgacaaccctctt
ttgtcaagtagtgacaagcagaagcttacagctacaagctcagagaagactgtcaagttt
ggaaatcctgctgcagcacaactgaacttgtcatccagtgcttcagcagcagcatcggta
ggaactactccacagaagtctggagagaccgctctaggtttcaagttgccaagtgcacct
tctatcgggaatggtctgttaaagattcaagcgactctgccatcgtttacgttaggtgcc
aatcccttgggtacgagtcttagtagtgctttaggaggcactcaagtggatgctaaagtg
cagtcacttagtactaataacaatgcggtcaccacatcgagagctggagctgggggtctt
gtgaagacaactcatcctggaaccctctctgcccctatcagtggggggtttacagctagt
ggtgctgctgctcccatttttggaggattttcaacaacagcagctcctgctacatccact
ctgaccacgacctcatcaataaaaacacaatttgcacccgcctttggtggtccaggtgca
gcctccggagttcagagcagtgctggaacaaccccaggaaaaccaagctctcaggcacaa
gcaggtggattccagtttggacaaactttgggaggctctacctcaatccccgctggagga
ctctcatttgggaataccaaaacgtcttctgttccaggtgggttagcaactccatttcaa
gctactgcacagacatctgccccagcttcaacagtaaataaacaaatgtcttctacgcct
gctcctaacaccactgcacctagtgctaaacaaggtggaggaccacaattcccacccatc
tttggccagcaagctgctactaaacctgcaggagcaaatggaccagggcaaggaggtcct
tcctttggatccaataccagccagccagcagcaggagggttcacatttggacagtcagta
tcttctgcgaccactgcagcagctcctcccgcttttaactttggtggcagcactcctaca
ccgacatcatctacaagtagcttgtttagttctgcaccggccacaccctttggtgcgagc
aaaccagccagtgctgtcggatcaaatctatttggttcaacacctgcacaaaaccagaca
ccccttggtggtgctcccacaaacaccagcaccatgtttggtggtgccaaagccacccca
caaaagccagccttcggtgccactaacaacacaagtatgtttggagctggaagcactcct
ggtgccacgtctgcaccgaaaccagcctttggaaatcccactgcaacgcttactcccttt
ggaagcagtcagagtcaactaccaccaccagctgcagcatcaccattccagtttggaagt
tctcaacctaaagcccctacacagcctgctgctacaggagggttcaactttggagggcaa
gcaacacctcagaaacctgttggttttggtgcctcagcaccagccccagcctcaaacaat
ggcttccagtttggccagacacagccgtcgagtggagctgcgacacagtctaacttcttc
gggggatctacagctaacacggccagtccattcggtggaggaggaggaggtggatttgga
actccagcaccaagtagcgggaacacccctgctccagcatttggagcgtcccccagccca
gccggtgcaacaggcttttccgtcgggactggagggaccaaccctgcctccaaccaaagg
aggatgaatagactcaaacaggttcgaaatagagcttcaaggaggtaa

DBGET integrated database retrieval system