KEGG   Strongylocentrotus purpuratus (purple sea urchin): 763219Help
Entry
763219            CDS       T01019                                 

Definition
uncharacterized LOC763219
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    763219
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1215 aa AA seqDB search
MRVIIGIAASLLVILCLSLFVLPFTLTVFLILTIGSFIAFHLSQNPAGVSRALAHVQSLS
AAAPKFWPPRPEEEATTRRTTAKPSSPTYQPKLTDSIKERGKENINNFVRSTLKPRRFGN
VVESSEFHGKSPQQSQSWVPLKNSTAANFSTTWSPRPATDKSEGFNFSTGYNFDNKLSFS
RLPLSPIYTPNKSIDSPELDLSSTMLRFNSGQDSLLHPSMHYPTHQPDLVASPGLLPSVS
WLKDGGLSSPRHRRGLPRVQSPVMVKIASLFPDRPASPLFRKLASENDKQKASSADKVIM
AIKLRQKRTAQDANTESGSPIAPSDVRSESKRRKLESTYGKDVARSDIDMDLDPMPRRKH
TDRVFWPSRYGITSPTPRNPIVSSFSSSRKSQSTLKRRMDTSSIEVEEEEGVSPIKKKAH
PQASQQSPGLQSPSKRTSANQPRTPGFSSIRSGGRALYLEKNTGLPAAGSPCKEAGTTPQ
KSSLKGKLFTPKRTSFAPRVDTPGDYTAADNKEDRAQARQRGSYLKEMLMQETEEGTSKD
GDSTVSAPKTNALFTGAAVTTTTASNPLTTFSIGSLPKSTASTTSVAPSVLSSTATTSSG
GTPALGIPSTSVQKTSDNPLLSSSDKQKLTATSSEKTVKFGNPAAAQLNLSSSASAAASV
GTTPQKSGETALGFKLPSAPSIGNGLLKIQATLPSFTLGANPLGTSLSSALGGTQVDAKV
QSLSTNNNAVTTSRAGAGGLVKTTHPGTLSAPISGGFTASGAAAPIFGGFSTTAAPATST
LTTTSSIKTQFAPAFGGPGAASGVQSSAGTTPGKPSSQAQAGGFQFGQTLGGSTSIPAGG
LSFGNTKTSSVPGGLATPFQATAQTSAPASTVNKQMSSTPAPNTTAPSAKQGGGPQFPPI
FGQQAATKPAGANGPGQGGPSFGSNTSQPAAGGFTFGQSVSSATTAAAPPAFNFGGSTPT
PTSSTSSLFSSAPATPFGASKPASAVGSNLFGSTPAQNQTPLGGAPTNTSTMFGGAKATP
QKPAFGATNNTSMFGAGSTPGATSAPKPAFGNPTATLTPFGSSQSQLPPPAAASPFQFGS
SQPKAPTQPAATGGFNFGGQATPQKPVGFGASAPAPASNNGFQFGQTQPSSGAATQSNFF
GGSTANTASPFGGGGGGGFGTPAPSSGNTPAPAFGASPSPAGATGFSVGTGGTNPASNQR
RMNRLKQVRNRASRR
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgatcattggaatagcagcttcattattagtaattttatgtctttctctattt
gttttgccttttactttgactgtattccttattttaacgatcggttcattcattgctttt
cacttgtcacaaaatccggctggtgtctcgcgagctctggcccacgtgcagtctttgtcc
gcggctgccccgaagttctggccgcctagaccggaagaggaggccacaactcgtcggaca
acagccaaaccatcttcgccaacttatcaaccaaagcttacagacagcatcaaagagaga
ggaaaagaaaacatcaataattttgtgagatcaactctgaagccaagaaggtttgggaat
gttgtagagtcgagtgaatttcatggaaaaagtccacaacaaagccaaagttgggttcct
ctgaaaaattccactgctgcaaatttttcaacaacatggagtccacgaccagccactgac
aagtctgaaggattcaatttttctactggatacaattttgataataaactctcattctcg
agactcccattgtcacctatctacacccctaacaaatcaatagacagtcccgaattggat
ttgagctcgacgatgctacgcttcaactcgggccaggattctttgcttcatcctagcatg
cactacccaacccaccaacctgacctggtggcctcccccggtctgcttccttcggtcagc
tggctgaaagatggaggactgtccagtcctagacacaggagaggtctacccagggtacag
agtccagtcatggtcaagatcgccagtctattcccagaccgtccggccagtcctctgttt
agaaaactagcatcagagaatgataagcagaaagctagcagtgcagataaggtcattatg
gctatcaaactgaggcagaagagaacggcacaggacgctaatactgagtccggtagtcca
atagcgccctctgatgtcagaagtgaatcaaagaggagaaaattggaaagcacctatgga
aaagacgttgcaagaagtgatatcgatatggatttagatcctatgcctaggcgtaaacat
acggacagagtcttctggccttcaagatacggaatcacatcacccacacctagaaaccca
attgtcagctccttcagttcatctaggaaatcccagagtacattaaagagaagaatggat
acatcatcaatagaggtagaagaggaggagggtgtatcacccatcaagaagaaggcccat
cctcaggcatcccagcaatctcctggtctccagagcccctccaagaggacaagcgccaat
caaccaagaaccccaggattttcatcgattagatctggcggtagagccctctacctggag
aagaacactggactaccagcagcagggtcaccctgtaaggaagcaggaacaacgcctcag
aaatcgagtctgaaggggaaactgttcactcccaagaggacttcatttgctccgagagta
gacacaccaggtgactacactgctgctgataacaaggaagacagagctcaggcaaggcag
agaggaagttacctcaaagagatgctcatgcaggagacagaggaaggcacctcaaaagat
ggtgattctactgtctcagctccaaagacaaatgccttgtttacaggagcagcagtaaca
acgacaacagcctctaaccctctgacgacattctctataggatcccttcccaagtctacg
gcttccactacaagtgtagcaccttcggttctgtcttcaacggccactacgtcttctgga
ggaacccctgctcttggtattccctcgacatccgtacagaagacaagtgacaaccctctt
ttgtcaagtagtgacaagcagaagcttacagctacaagctcagagaagactgtcaagttt
ggaaatcctgctgcagcacaactgaacttgtcatccagtgcttcagcagcagcatcggta
ggaactactccacagaagtctggagagaccgctctaggtttcaagttgccaagtgcacct
tctatcgggaatggtctgttaaagattcaagcgactctgccatcgtttacgttaggtgcc
aatcccttgggtacgagtcttagtagtgctttaggaggcactcaagtggatgctaaagtg
cagtcacttagtactaataacaatgcggtcaccacatcgagagctggagctgggggtctt
gtgaagacaactcatcctggaaccctctctgcccctatcagtggggggtttacagctagt
ggtgctgctgctcccatttttggaggattttcaacaacagcagctcctgctacatccact
ctgaccacgacctcatcaataaaaacacaatttgcacccgcctttggtggtccaggtgca
gcctccggagttcagagcagtgctggaacaaccccaggaaaaccaagctctcaggcacaa
gcaggtggattccagtttggacaaactttgggaggctctacctcaatccccgctggagga
ctctcatttgggaataccaaaacgtcttctgttccaggtgggttagcaactccatttcaa
gctactgcacagacatctgccccagcttcaacagtaaataaacaaatgtcttctacgcct
gctcctaacaccactgcacctagtgctaaacaaggtggaggaccacaattcccacccatc
tttggccagcaagctgctactaaacctgcaggagcaaatggaccagggcaaggaggtcct
tcctttggatccaataccagccagccagcagcaggagggttcacatttggacagtcagta
tcttctgcgaccactgcagcagctcctcccgcttttaactttggtggcagcactcctaca
ccgacatcatctacaagtagcttgtttagttctgcaccggccacaccctttggtgcgagc
aaaccagccagtgctgtcggatcaaatctatttggttcaacacctgcacaaaaccagaca
ccccttggtggtgctcccacaaacaccagcaccatgtttggtggtgccaaagccacccca
caaaagccagccttcggtgccactaacaacacaagtatgtttggagctggaagcactcct
ggtgccacgtctgcaccgaaaccagcctttggaaatcccactgcaacgcttactcccttt
ggaagcagtcagagtcaactaccaccaccagctgcagcatcaccattccagtttggaagt
tctcaacctaaagcccctacacagcctgctgctacaggagggttcaactttggagggcaa
gcaacacctcagaaacctgttggttttggtgcctcagcaccagccccagcctcaaacaat
ggcttccagtttggccagacacagccgtcgagtggagctgcgacacagtctaacttcttc
gggggatctacagctaacacggccagtccattcggtggaggaggaggaggtggatttgga
actccagcaccaagtagcgggaacacccctgctccagcatttggagcgtcccccagccca
gccggtgcaacaggcttttccgtcgggactggagggaccaaccctgcctccaaccaaagg
aggatgaatagactcaaacaggttcgaaatagagcttcaaggaggtaa

DBGET integrated database retrieval system