KEGG   Strongylocentrotus purpuratus (purple sea urchin): 763248Help
Entry
763248            CDS       T01019                                 

Definition
(RefSeq) choline kinase alpha
  KO
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    763248
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     763248
    2.7.1.82  ethanolamine kinase
     763248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 379 aa AA seqDB search
MEEDFAVDNTTKLKAYTWCQEYLGGVWTQIDLEDFHIRDLSELNALRAGEVLLRVYARSS
LRAETPLLDTVIFSLLSERRRAPKLYGVFSEGRLEEFIPSRALRTDELSNPELSRIIAGK
LAGFHQLQLPLCKTPRWLDQVLDKWFNKALGLTFEDDSDQQFMKQIMAFDLDEERTFIKR
LLSQTKSPVVFGHNDCQEGNILLTSGENTDEKNLILIDYEYSSYNFREFDLANHFVEWSM
NYCIKDAPYFSLKPEDFPSREQQLIFIRAYLAANREMGVYQPGCHGDSADEEEAILREVK
RFCPVSHFVWALWSIVQAKISHTTFGYMEYAVARFKEYFRHKALIPLDMLPSTADQRNHG
TTDESASTQPIDQRRAIVT
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagattttgccgtagataacacaacaaaactgaaggcgtatacgtggtgtcaa
gaatatcttggaggcgtatggacgcagatcgacttggaagatttccacatccgtgatttg
agcgagctaaatgcactacgagcaggcgaggtccttctccgcgtctacgcgagatcttct
ttgagggccgagacgccgcttcttgacaccgtgatcttctcgttgctctcggagaggagg
agagcaccgaagctctacggggtcttcagcgagggacgacttgaagaattcattccatcc
cgtgccctaagaaccgatgaactatcgaatccggaactctctaggatcatcgccggcaag
ctagctggcttccatcaactccagcttcctctgtgtaagacaccaagatggctggaccaa
gtgctagacaaatggttcaacaaggctcttggattgaccttcgaagatgacagtgaccaa
cagttcatgaaacagattatggccttcgaccttgatgaagagagaacatttatcaagaga
ctgttgtcacagacgaagagtccagttgtcttcggtcacaatgattgccaagaaggaaac
atccttctcaccagcggggagaatacagacgagaagaacctgatcctgattgattatgag
tattcaagctataatttcagagagtttgatttggccaatcactttgttgaatggtccatg
aattattgcatcaaggacgcgccctacttctccctcaagccggaggacttcccctccaga
gagcagcagctgatattcatcagggcgtacctcgcagccaaccgagagatgggcgtgtac
cagccaggttgccatggggactcggcagacgaagaagaagctattctacgagaagtgaaa
aggttctgtccagtcagccattttgtatgggctctgtggtctatcgttcaagctaaaata
tcccacacaacctttgggtacatggaatacgccgtcgcgaggttcaaggagtatttccgg
cacaaggccttgatcccgctggacatgctcccgtcgaccgccgatcagaggaaccacgga
accaccgacgaaagtgcctcgacccaacccattgaccagagacgagccatcgtcacctga

DBGET integrated database retrieval system