KEGG   Strongylocentrotus purpuratus (purple sea urchin): 763473Help
Entry
763473            CDS       T01019                                 

Definition
(RefSeq) late histone H2B.L3-like
  KO
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   763473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 139 aa AA seqDB search
MPPKSSATGVGKKGSKKAKAPRPSGDKKRRRKRKESYGIYIYKVLKQVHPDTGISSRAMS
IMNSLVNDVFERIAAEASRLAHYNKKSANINMTNKDIDMTNHLPTKLKKNKKRPVEKSAT
RAMNDQEWKAFNRTNCTAL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgccacccaaatcatctgcaaccggagtaggaaagaagggatcgaagaaggctaaggcc
cctaggcctagcggtgacaagaagaggagacgaaaacgtaaggaaagctacggaatctac
atctacaaggttctgaagcaggtccaccccgacaccggtatctccagccgtgccatgtcc
atcatgaacagcttggtcaacgatgtcttcgagcgcatcgccgccgaggcttcccgtctt
gcccactacaacaagaagtcggctaacattaatatgacaaacaaagatattgatatgaca
aatcatttacctactaaactaaagaagaacaagaagcgaccagttgaaaagagtgcaacg
agggccatgaatgaccaagagtggaaggcatttaacaggacaaactgcacagcattataa

DBGET integrated database retrieval system