KEGG   Strongylocentrotus purpuratus (purple sea urchin): 763697Help
Entry
763697            CDS       T01019                                 

Definition
glutaminase kidney isoform, mitochondrial-like
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    763697
   00330 Arginine and proline metabolism
    763697
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    763697
Enzymes [BR:spu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     763697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 587 aa AA seqDB search
MMSSVATRWRCLLTTQRTIAQMTRCLSTQGLVNCRKTKLTHPAKQMPCLARGFRSTSYCL
NEDPNTGFPSLEELVFNMLSQGDGTISVSTFFDALQAKGLTLNDPRLKESMDNFRSKHLP
QFPERIGDKYLTADEFKDCVQDNIVLIGRALQNKLIIPDFPEFAATIQETFEEAKNNETG
ELADYIPQLARQDPNAWGVSICTIDGQRCSFGNTSDHFSFQSSSKAPAYALASTLMGSDF
VHRHIGFEPSGQSFNALFLNNNNTPHNPMLNSGAIVTAALIKPELTAADRFDFIMSKFRE
AAGGEYIGFSNATFLSEKKTGFRNFAITYLLQDYNCFPPGADPVDTLELYFQICSLEVNC
ESASVMAATLANGGICPLTGKKVFESVAVRDTLSLMLSCGMYDFSGQFAFKVGMPAKSGV
SGCVMLVVPNIMGIMMWSPLLDNFGNSCRGIQFCQDLVTHFNFHNYDNLRHHSAKKIDPV
TQRTHSQATRTMKLLFGAYNGDASALRQYFLQGMDMAESDYDSRTALHLAAAEGHTECVE
FLLEKCNVSPDVLDRWGHTPLDDARLFGHTGVVDILENFKARRQEET
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcatcagtggccacaagatggcggtgtctactcacgacgcagcgaaccatagcg
cagatgacaaggtgtttatctacgcagggacttgtcaactgccgcaagactaaacttact
caccctgcaaaacagatgccatgccttgcgcgaggtttcagaagcacaagttattgtctt
aatgaagaccctaataccggctttcccagcctggaggagcttgtgtttaacatgttgagt
caaggtgatggaaccatctcagttagcacgttctttgatgctctgcaagcaaaaggtttg
accctgaacgaccccagactgaaagagtcgatggataacttccgttcaaaacatcttcct
cagtttccagagagaataggagataaatatctcactgctgatgaatttaaagactgcgta
caagacaacattgtcctgattggacgtgcccttcagaacaagcttatcatccctgacttc
cctgagtttgctgccaccatccaagaaacgtttgaagaagctaagaacaatgaaactgga
gagttggcggactacatcccccagctggcccgtcaggaccctaacgcctggggggtgagc
atctgcaccatcgatggccagcgatgttcctttggtaacacgtcggaccacttctccttc
cagtccagcagcaaggcgcctgcttacgccctcgcctccaccctcatgggctccgacttt
gtccacaggcacatcggttttgaaccgagcggccagtctttcaacgccttgttcctgaac
aacaacaatacaccacataacccaatgttgaactctggagccatagtgactgccgcccta
atcaagcctgaactgactgcagctgatagatttgatttcatcatgtctaagttcagagag
gcagcagggggagagtatataggattcagcaatgccacattcctatcagagaagaagaca
ggtttcaggaactttgcaattacctatctgctccaggactacaactgcttcccacctgga
gctgaccctgtggacacccttgaactctacttccagatctgttcgttggaggtgaattgt
gagtcagcttctgtcatggcagccaccctggccaacggtggcatctgtcctctgaccggc
aagaaggtctttgagtcggtggcggtcagagacaccctgagtctcatgctctcctgcggg
atgtacgacttctcaggacagtttgctttcaaggtgggcatgccagctaaatcgggtgtg
tcaggctgtgtcatgctggtggtgccaaacatcatgggtatcatgatgtggtctccactc
cttgacaactttggcaacagctgcagaggcatccagttctgtcaggatctggtaacacac
ttcaacttccacaactatgacaacctgaggcatcattcagctaagaagattgacccggtt
actcagaggacacatagccaggccacgcggaccatgaagttattatttggtgcttacaac
ggagatgctagtgctctcaggcagtacttcttacagggcatggacatggctgagagtgat
tacgatagtaggacagcccttcatctagctgctgcagagggtcatacagaatgtgtagag
ttcttacttgagaaatgcaatgtaagccctgatgtactagacagatggggccacacccct
cttgacgatgcaaggctcttcggtcatacaggagttgtcgacatactagaaaacttcaaa
gccagaaggcaggaagagacatga

DBGET integrated database retrieval system