KEGG   Strongylocentrotus purpuratus (purple sea urchin): 764059Help
Entry
764059            CDS       T01019                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    764059
   00053 Ascorbate and aldarate metabolism
    764059
   00500 Starch and sucrose metabolism
    764059
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    764059
   00860 Porphyrin and chlorophyll metabolism
    764059
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    764059
   00982 Drug metabolism - cytochrome P450
    764059
   00983 Drug metabolism - other enzymes
    764059
Enzymes [BR:spu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     764059
Glycosyltransferases [BR:spu01003]
 Others
  Hydrophobic molecule
   764059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 217 aa AA seqDB search
MKEELIAVFANAFAKLPQKVIWQFRGTPPAILDKIPNIKTMEWLPQNDLLGHNKTRAFMY
QGGNNGLYEALYHAVPVVVIPLIGDQPDVAARVMTRGMGLSLDIMTITTEKIVDTLNAVI
HEKHYKETVKRMSAIFHDRPMRPVEKAAFWIEHVIKHGGEYMRSPIHDLTWYQYYLLDVV
AFLLLVLVVVIVFIVYSCKFAFRCCKRVLVGKKAKTD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggagctcatcgccgtattcgccaacgccttcgccaagctccctcagaaagtc
atatggcagttccgaggcacgccacccgctatcctcgataagatacccaacataaaaacc
atggagtggctgcctcaaaacgacttgcttggtcacaacaaaacccgagcattcatgtac
cagggaggtaacaacggcctctacgaagccctctaccatgccgtgccggtcgtcgtcata
cccttgatcggcgaccagcccgacgtcgccgctcgtgtgatgactcgtggcatggggctc
tcactcgacatcatgaccattactacggagaagatcgttgacactctcaatgccgttatt
catgaaaagcattacaaagaaacggtaaaacgaatgtccgctattttccacgaccgaccg
atgcgacccgtcgaaaaggccgcgttttggatcgaacacgtaatcaagcacgggggcgag
tacatgcgatcaccgattcatgacctcacctggtatcaatactacctcctcgatgtcgtc
gcctttcttcttctcgtgctcgtcgtcgtaatcgtttttatagtttattcgtgtaaattt
gcatttaggtgttgcaagcgagttttagttggtaagaaagcaaaaactgattag

DBGET integrated database retrieval system