KEGG   Strongylocentrotus purpuratus (purple sea urchin): 764143Help
Entry
764143            CDS       T01019                                 

Definition
ubiquitin carboxyl-terminal hydrolase 47-like
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     764143
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   764143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 611 aa AA seqDB search
MVPIDNSQLVPTNDTCTADLPKILCIIYDITNPQWQTCKFTVTLPTSTTTVELCEEVARQ
ANYEPDTFELYWLRAGKDGNDNLLLNDKGQKSLGELGMLTVGRNLFNLQDKDGAQPVPIQ
GQKSLGELGMLTVGRNLFNLQDKDGAQPVPIQGQKSLGELGMLTVGRNLFNLRDKDGAQP
VPIQCQRSLGELGMLTVGRNLFNLQDKDGAQPVPIQAGASGTTKSPSEIDALNLATDDTS
PIITATSDTSSLSSDYSSYVPYSSAVIGRSETGFVGLVNQAMTCYLNSLMQTLYMTPEFR
NAVYKWEYTDTQEERSKSIPYHLQRLFIQLQTSKKRSIETTDVTRSFGWDSSEAWQQHDV
QELCRVMFDALEKKWKNTDQSNLINQLYQGQLKDYVKCLKCGYESARSDAFLDIPLVIRP
FGANKVYSSVDEALRAFVEPETLDESNQYFCEKCNMKCDAHKGLKFQHFPYLLTLQLKRF
DFDYNTMHRIKLNDKMTFPEILDLNAFVVSEADSQGEPPTKTTVQAYVEGETQSDSGAEN
EDGSPSSQSQENSLEDALDEGIVMEQASTTAITNHRNDQERQTRGPYTYELFSIMVHSGT
ASGGHYYAYIK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggtaccgatagacaacagccagctggttccaacaaacgatacttgcacggctgacctc
cccaagatcctgtgtatcatctatgatatcaccaaccctcaatggcagacatgcaagttc
accgtcaccctgccgacgtcaacgaccacggtagaactgtgcgaggaggtggcgcgccag
gctaactacgaaccggatacctttgaactctactggctgagggccggaaaagatggcaat
gacaatcttttgttgaacgacaagggtcagaagtcactcggtgagctaggcatgctgact
gtaggaaggaatctattcaacctacaagacaaggatggggcacaaccagtccctatacag
ggtcagaagtcacttggtgagctgggcatgctgactgtaggaaggaatctattcaaccta
caagacaaggatggggctcaaccagtccctatacagggtcagaaatcactcggtgagcta
ggcatgctgactgtaggaaggaatctattcaacctacgagacaaggatggggctcaacca
gtccctatacagtgtcaaaggtcacttggtgagctaggcatgctgactgtaggaaggaat
ctattcaacctacaagacaaggatggggctcaaccagtccctatacaggctggggcaagc
ggcacaaccaaatctcccagtgaaatagatgctttgaacctagctacggacgacactagc
ccgatcatcactgcaacatctgataccagctctctatcatccgactactcctcctacgtc
ccttactcctcggctgtcattggaagatcagaaacaggttttgttggtctagtcaaccag
gcaatgacgtgttatctcaacagcttgatgcaaacactttacatgactccagagtttaga
aatgctgtctacaaatgggagtacaccgatacacaggaggagagatctaagagtataccc
tatcatcttcaacgtctcttcattcagcttcagaccagtaagaagaggtcaatcgagaca
acagacgtcacacgaagctttggatgggatagcagtgaagcttggcagcagcatgatgtc
caggagctgtgcagggtcatgttcgatgcactagagaagaaatggaagaacacggatcag
agtaatcttataaaccagctctaccagggtcagctcaaagattatgtcaagtgtttaaag
tgtggctatgagagcgcaagatcagatgctttcctggacatcccgttggtgatcagacca
ttcggtgccaacaaggtctacagcagtgttgacgaggctttgcgagcctttgtggagcca
gagactttggatgagagtaaccagtacttctgtgagaaatgcaacatgaaatgcgatgct
cataagggcctcaagttccaacactttccctacctcctcactctgcaactcaaacgattt
gactttgactacaacacaatgcatcgcatcaaactcaatgacaaaatgacgttccccgag
attctcgacctaaacgcatttgttgtatccgaggctgactcgcaaggggaaccgcctaca
aagacgaccgtgcaagcatatgttgaaggtgagacgcagtccgacagtggggctgagaac
gaggacggaagcccgagcagtcagagtcaggagaactcactagaggatgccctcgacgag
ggaatcgtgatggagcaggcctcgactacagccatcaccaatcacaggaatgatcaggag
cgacagacgagggggccctacacctacgagctcttctccatcatggtgcattctgggacg
gcgtcgggcggacattactatgcatatatcaagtga

DBGET integrated database retrieval system