KEGG   Strongylocentrotus purpuratus (purple sea urchin): 764341Help
Entry
764341            CDS       T01019                                 

Definition
(RefSeq) uncharacterized LOC764341
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    764341
Enzymes [BR:spu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     764341
Chromosome [BR:spu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     764341
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    764341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1356 aa AA seqDB search
MAEIAEAFLLKVTAGLDDELAKLDKKITKFTNVETPQNEKLLGDIGSIHAHIGELHDEIQ
GLLNKQEERKEAEKARQDEYERDHLFKSSIMPSNPRTLHELYEEMDLLDIDSDDDDQDSG
NEMDDDDGVAGEDEIIFLGKTDLPTRQKRSANEARLTPPAPPSQPAGPIDKEADGKMGAV
AAISSQKTPAAPSQGTLPSSILGAQETSKVIIIPPGPSGQATSTSSSSLGGQTTTPVVDR
SVAAERVMTIPASTVASIQQEGSAKSVVLPSALIPGLKDFNQQSKAPLRFLMVTTAKNQA
GQPVKSVKTLVLQNPQGVPLDGHVVLKIQEGKPQPGQIKQYGQDASAAGPVLQTSAAKRP
PATSEVVEIIDDDDDIVMLSSTPASSVSKKTTVLRATARAPSAVPGQVQGGSPGGKARQG
VQLIHGGDYDAHMMEGEEMMFGDDDATLPELVEGKKVLAKGEESFWFPGTLIGPPIHHKG
MKKYKVKFEHGRKRLLSSKFLAVITPSKPGDLAVGIRVVASYLVEEGAKTKGMYAGIIAE
VPMKTNRGRYLVFFDDGYAQYLSCEKIHIVYHSSACVWADVDIFSRDFIREYLDKYPDRA
MVNLKRDQVVTTEWNGKWWNARVLEVQGSLANMLFEATPSRGAETEWIYRGSTRLKPLLD
LGDKKTAGINTVPTPDQLRHNLPYVEMTKVHSDHILPGMYKLTTLYCKPYPKFLSIVEKS
KMKETRSEVLSVDRFTFAPHVHISFNQRRTRQNSRIYYMQLTDLSNGVEKVPVSKKYKVK
FEHGRKRLLSSKFLAVITPSKPGDLAVGIRVVVLELGKFLPMYHASETLPRLAQDNSGGE
DEIALCTAETPRKEGIRMEASYLVEEGAKTKGMYAGIIAEVPMKTNRGRYLVFFDDGYAQ
YLSCEKIHIVYHSSACVWADVDIFSRDFIREYLDKYPDRAMVNLKRDQVVTTEWNGKWWN
ARVLEVQGSLANMLFEATPSRGAETEWIYRGSTRLKPLLDLGDKKTAGINTVPTPDQLRH
NLPYVEMTKVHSDHILPEQQIPQPKPTMLGRLNDPQGSAATSSSPYHFSQLLQQCAQQTT
PTPSFAKKSSASVSGSTSSLYESSRSEHKKKKKKKNKHKDRRKERYEEDKLFEPETKLDL
PATKERLRYMPHECRPICLGPIPQVVDHNQNPLLWPMDLGWVRELCKQGGSSYKRHVIYR
TPCGKSLQFVMAFVTKSLAMVRMASEWEAFQNALRMHHPYKVKIFSTTIFYSFESLTECT
ASWPRADINLICVNEYDTDEPPPLIYMTERQAVLRGTKVNTDPNFLICCDCTDNCSLQLE
CGIYECNDKCKCSKQCQNKVVQNGLSLRLQVFKTYD
NT seq 4070 nt NT seq  +upstreamnt  +downstreamnt
atggctgagattgcagaagcattcctgttgaaggtcactgcgggattagacgatgaactt
gccaagcttgataaaaagatcacgaagtttaccaatgttgagacgccccaaaatgaaaag
ctgcttggtgatattggtagcattcacgcccacatcggggagcttcatgatgaaatacag
ggtcttctcaacaaacaagaagagcgcaaggaggccgaaaaggcgagacaagatgaatat
gaaagagaccatttattcaagtcctccattatgcctagcaatcccagaactctccatgaa
ctctatgaggagatggatctccttgacattgattcagacgacgacgaccaggacagcggc
aatgagatggatgacgatgatggtgttgccggtgaagatgagatcatcttccttggaaag
acggacctaccaacaaggcagaaacggtcagcaaatgaagctcgtcttacaccaccagcg
ccacccagtcaaccagcaggacccatagacaaagaggctgatggaaagatgggagcagtg
gcagccatttcatcacagaaaacaccagcagcaccatcccagggcactctgccatcatca
atactaggtgcccaggaaacctccaaggttatcatcattccaccaggaccctcgggacag
gcaacatccacatcgtccagttccctgggtggccagactacaacacctgttgtggaccgg
tcagtggcagccgaacgtgtgatgactatccctgcctccacagttgccagtattcaacag
gaaggctctgcaaaaagtgttgttttaccatcagcattgataccaggactcaaggacttt
aaccagcagtcgaaggcacccttgcgttttctgatggtaaccactgcaaaaaaccaggct
ggccaaccggtgaagagtgtgaagacattggttctgcagaatcctcagggggtaccgctg
gatgggcatgtggtattgaaaatccaagagggaaaaccgcaaccagggcagatcaagcag
tatggacaagacgcctctgctgctggaccagtcttgcagacgtcggcagcgaagcgtccc
ccggctacgtccgaggtggtcgagatcatcgatgatgatgatgacattgtgatgctgagc
agtactccagcatcctctgtctccaagaagaccactgttctcagagcaaccgccagagct
ccatctgccgttcctggacaagtccaggggggaagtccaggggggaaggctcgtcaaggg
gtgcagctcatacatggaggtgactatgatgctcacatgatggaaggagaagaaatgatg
tttggagatgacgatgctacgttaccagaacttgttgaaggaaagaaggtactagccaag
ggggaggaaagtttctggtttccaggaacactcattggtcctcctatacatcataaagga
atgaaaaagtacaaggtgaaatttgagcatggccggaagcgactgttgtccagtaagttc
ttagctgtcattacgccctctaagccaggtgaccttgccgttggtattagagtagttgct
tcttatttggtagaggaaggggccaagacgaaagggatgtatgctggtatcatagcagag
gttcctatgaagaccaacagaggaagatatttggtgttttttgacgatggttacgctcaa
tatctatcgtgtgagaagatccatatagtctatcattcaagcgcctgtgtttgggcagat
gtggatattttctcccgagatttcatcagagaatatctggataagtaccctgaccgggca
atggtcaatctcaagagggatcaagtggtcactacagaatggaatggcaaatggtggaat
gctagagtgcttgaggtacagggtagtcttgctaacatgctctttgaagctacgccatcc
agaggagcagagacagaatggatctatagaggctctaccaggcttaaaccccttctcgat
ttgggtgacaagaagactgctggtatcaatactgttccaactccagatcaattgcgacat
aatcttccatatgttgaaatgaccaaagtacattcagaccacattctaccaggtatgtat
aagttaacaacgttgtattgtaaaccgtaccccaaatttttatccatcgttgaaaaaagc
aaaatgaaggaaaccagatctgaagtgttgtccgtagatcgcttcacctttgccccacac
gtccacatcagtttcaaccagcggcgcacaaggcagaacagtcggatatattacatgcag
ctcacagatctatctaatggggtagagaaggttcctgtttcgaaaaagtacaaggtgaaa
tttgagcatggccggaagcgactgttgtccagtaagttcttagctgtcattacgccctct
aagccaggtgaccttgccgttggtattagagtagttgtgcttgagttgggaaaattttta
ccgatgtaccatgccagcgagacgctgcctcgcctggcacaggataatagcgggggtgaa
gatgagatagctctatgcaccgccgagacgcctaggaaggaaggcatccggatggaagct
tcttatttggtagaggaaggggcaaagacaaaagggatgtatgctggtatcatagcagag
gttcctatgaagaccaacagaggaagatatttggtgttttttgacgatggttacgctcaa
tatctatcgtgtgagaagatccatatagtctatcattcaagcgcctgtgtttgggcagat
gtggatattttctcccgagatttcatcagagaatatctagataagtaccctgaccgggca
atggtcaatctcaagagggatcaagtggtcactacagaatggaatggcaaatggtggaat
gctagagtgcttgaggtacagggtagtcttgctaacatgctctttgaggctacaccatcc
agaggagcagagacagaatggatctatagaggctctaccaggcttaagccccttcttgat
ttgggtgacaagaagactgctggtatcaatactgttccaactccagatcaattgcgacat
aatcttccatatgttgaaatgaccaaagtacattcagaccacattctaccagagcaacag
atacctcaacccaagcccacgatgctaggcagacttaatgaccctcaaggctcagcagct
acatcatcatcaccataccacttctctcagctccttcaacagtgtgctcaacagacaact
cctactccctcgtttgccaagaaatcctccgcatctgtatctggctctactagcagtctg
tatgagagcagcaggagtgagcacaagaagaagaaaaagaagaagaacaaacacaaagac
aggagaaaagagaggtatgaggaggataaattgtttgaaccagaaaccaaactagacctt
ccagctacaaaggagagactgagatatatgcctcacgagtgtcgtcccatctgtcttggg
cccattccccaagtggttgatcacaatcagaacccgctgctctggcccatggatctaggt
tgggtgagagagctttgtaagcagggaggtagcagctacaaacgacacgtcatctacaga
acgccctgtggcaaaagtctgcagttcgtaatggcatttgtgaccaagtctttagctatg
gttaggatggcgtcagaatgggaagcattccaaaatgctctaagaatgcatcatccatac
aaagtcaagatcttcagcacgactatcttctactcgttcgaatccttaacagaatgcact
gcttcgtggccgagagctgatatcaacctcatatgtgtgaatgagtacgacacagacgag
cctcctcctctgatatacatgactgaacgacaggctgtgctgagagggacaaaggtcaat
acagatcctaacttcctgatatgctgtgattgtactgataactgctcacttcaactcgag
tgtgggatttatgagtgcaatgataagtgcaaatgctccaagcagtgtcagaacaaagtg
gtacagaatggactctccctgagactacaagtctttaagacctatgacag

DBGET integrated database retrieval system