KEGG   Strongylocentrotus purpuratus (purple sea urchin): 764571Help
Entry
764571            CDS       T01019                                 

Definition
(RefSeq) single-strand selective monofunctional uracil DNA glycosylase
  KO
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    764571
Enzymes [BR:spu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     764571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 453 aa AA seqDB search
MAALNHFGALDAPSVTHADRRGGRVLTYRGYRYTRSNSSHTRIYWRCARVNCGETIITNR
FNINHTNPEIHIQQRPLGDHTHEPDDERIRRRQFIDEATALLRTNPTLVIRRAYDTVRDT
GNHYPPDIPTFKEIRSQLQRVRSEIVNIDRIIMPRKKLKTGGPSGDNPATSVTTPPPPPP
PAASGLPTTPPPTPLPSSATTQSNRDESVAEKFISLMEDMVRELDKLKFGDPVSYIYNPL
EYAKETHDCFVRKYGNSTKSVLFLGMNPGPFGMAQNGVPFGETNYVKDWMKITGNVGRPP
KEHPKRIIIGLDCNRSEVSGQRFWKLWKDLCGTPENFFKECFVYNHCPLVFMTSTSKNVT
PPSMKIEMRNPLNDVCDDYLCWLIQLLGVKVVVGIGKFAEARTKKALEKGGVEGVRVVTI
MHPSPINPAANKGWQNIVEKSLEDLDLMKYISK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcagccttgaatcacttcggggcacttgatgccccgtctgtcacacatgcagacagg
cgaggtgggagagttttgacctacagaggctatagatacacccgtagcaacagttcacac
actcggatctattggcgatgtgcaagagtcaactgtggtgaaacaatcataacaaaccgc
ttcaacattaatcatacaaatccggagattcatattcaacagcggccgcttggggatcac
acgcatgaacctgatgatgagcgaatccgtcgaagacaatttattgacgaagcaactgca
ttgctcagaactaatccaactcttgtcataaggagggcatacgacactgttcgagataca
ggaaaccactatccgccagatatacccacatttaaggaaatcagaagccagctgcaacga
gtccgttcggaaattgttaacattgatagaatcataatgcctcgcaagaagctcaagaca
ggtggaccatcaggagataatcctgcaacgtctgtgacaacaccaccaccaccaccacca
ccagcagcatcaggcttgccaacaactccaccacccacacctctcccaagctctgcaaca
actcagtcaaatagagacgaaagcgttgcagaaaagttcatctcgctaatggaggacatg
gtgagagaactggacaagctcaagtttggcgaccctgtgagttacatctacaatcctctg
gaatatgccaaggagactcatgactgtttcgtcagaaagtatggcaactcaaccaagtct
gtgctctttcttggaatgaatcctggtccattcgggatggcacagaatggggtaccattt
ggagaaaccaactatgtgaaagactggatgaagattacagggaatgttggcagaccccca
aaggaacatcccaagcgtatcatcattggacttgactgtaaccgtagtgaggtcagtgga
cagcgtttctggaaattatggaaggatctgtgtggcactccagagaacttcttcaaggaa
tgttttgtgtacaaccattgccctctagtgttcatgacgtcaacgagcaagaacgtcact
cctccgtccatgaagatcgagatgcgcaatcctctgaatgatgtctgtgatgactatcta
tgttggttgatccaactgctgggggtgaaggtggtggtagggataggcaagtttgccgag
gctaggaccaagaaggccctcgagaagggaggggtggaaggggtgcgggtggttaccatc
atgcacccaagtcctattaatcctgctgctaacaagggatggcaaaatattgttgaaaag
agcttagaagatcttgatcttatgaagtatatcagtaaatag

DBGET integrated database retrieval system