KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0172Help
Entry
SPH_0172          CDS       T00658                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
spv00010  Glycolysis / Gluconeogenesis
spv00052  Galactose metabolism
spv01100  Metabolic pathways
spv01110  Biosynthesis of secondary metabolites
spv01120  Microbial metabolism in diverse environments
spv01130  Biosynthesis of antibiotics
Module
spv_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPH_0172
   00052 Galactose metabolism
    SPH_0172
Enzymes [BR:spv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SPH_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACA37568
UniProt: B1I7X3
Position
149945..150982
Genome map
AA seq 345 aa AA seqDB search
MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAPDKAGNFANVILGFDD
FDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNCNHSGSTGWDSSLFEVE
EVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEISYKVTTDQDTLVNPTNHSYF
NLSGDFTQTIDRHVFQLNTEGIYSITPDGVPAKTPEANRDVVKHIYNGTLLKDIFAEEDE
QIQLASGLDHPFALPVGHDNAGFLYDQNSGRFLLFKTEAPCFVVYTANFVDESVIIGGQP
MLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRYELVVK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatacacagagcgtgtatttggaaatgttgagggcgaggatgtcttggcctat
cgatttgagacagacggtggctaccaacttgaggttatgacttatggtgcgaccatcttg
cgctatgtcgcacctgacaaggctggaaattttgccaatgttatcttgggatttgatgac
tttgatagttatgtaggcaatagtcccaagcatggagcaagtgtaggtcctgtagcgggt
cgtattgcaggtgcgacctttgagctcaatggtaagacctatgaccttgaggttaataat
gctagcaactgtaatcacagtggttcaactggttgggattccagcttgtttgaagttgaa
gaagtaagcgatcatggcttgactctctacacagagcgtacagatgggacaggagggttc
cctggaaatctcaagatttggatcagttatcacttggaagaaactggtgcctatgaaatt
agctacaaggtaacgaccgatcaggatacgctggtcaatccaaccaaccacagctatttc
aacttgtctggtgatttcacgcagacgattgaccgtcatgtcttccaactaaacacagag
ggcatttactcaatcactcctgacggtgttcctgccaaaactccagaagccaaccgtgat
gtggtcaaacacatctacaatggtaccttgttgaaggatatctttgcagaagaagatgag
caaatccagctggcatcaggtttggatcacccatttgcccttcctgtaggccatgacaat
gctggattcctttatgaccaaaattcaggtcgcttcctgcttttcaagacagaagctcct
tgctttgtggtctacacagcaaactttgtggatgaaagtgtcatcataggaggtcagcca
atgctacagcacaatgggattgctcttgaagcgcaagctttaccagatgccattcacagt
gaccttaaaggccaagtcattcttaaagctggtcaaaccttcaccagtaagacacgttat
gaacttgttgtgaaataa

DBGET integrated database retrieval system