KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0172Help
Entry
SPH_0172          CDS       T00658                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spv00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spv00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
149945..150982
Genome map
AA seq 345 aa AA seqDB search
MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAPDKAGNFANVILGFDD
FDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNCNHSGSTGWDSSLFEVE
EVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEISYKVTTDQDTLVNPTNHSYF
NLSGDFTQTIDRHVFQLNTEGIYSITPDGVPAKTPEANRDVVKHIYNGTLLKDIFAEEDE
QIQLASGLDHPFALPVGHDNAGFLYDQNSGRFLLFKTEAPCFVVYTANFVDESVIIGGQP
MLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRYELVVK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatacacagagcgtgtatttggaaatgttgagggcgaggatgtcttggcctat
cgatttgagacagacggtggctaccaacttgaggttatgacttatggtgcgaccatcttg
cgctatgtcgcacctgacaaggctggaaattttgccaatgttatcttgggatttgatgac
tttgatagttatgtaggcaatagtcccaagcatggagcaagtgtaggtcctgtagcgggt
cgtattgcaggtgcgacctttgagctcaatggtaagacctatgaccttgaggttaataat
gctagcaactgtaatcacagtggttcaactggttgggattccagcttgtttgaagttgaa
gaagtaagcgatcatggcttgactctctacacagagcgtacagatgggacaggagggttc
cctggaaatctcaagatttggatcagttatcacttggaagaaactggtgcctatgaaatt
agctacaaggtaacgaccgatcaggatacgctggtcaatccaaccaaccacagctatttc
aacttgtctggtgatttcacgcagacgattgaccgtcatgtcttccaactaaacacagag
ggcatttactcaatcactcctgacggtgttcctgccaaaactccagaagccaaccgtgat
gtggtcaaacacatctacaatggtaccttgttgaaggatatctttgcagaagaagatgag
caaatccagctggcatcaggtttggatcacccatttgcccttcctgtaggccatgacaat
gctggattcctttatgaccaaaattcaggtcgcttcctgcttttcaagacagaagctcct
tgctttgtggtctacacagcaaactttgtggatgaaagtgtcatcataggaggtcagcca
atgctacagcacaatgggattgctcttgaagcgcaagctttaccagatgccattcacagt
gaccttaaaggccaagtcattcttaaagctggtcaaaccttcaccagtaagacacgttat
gaacttgttgtgaaataa

DBGET integrated database retrieval system