KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0353Help
Entry
SPH_0353          CDS       T00658                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:spv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:spv01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spv00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:spv00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:spv00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
300239..300931
Genome map
AA seq 230 aa AA seqDB search
MVKVRLYLVRHGKTMFNTIGRAQGWSDTPLTAEGERGIQELGIGLRESDLQFERAYSSDS
GRTIQTMGIILEELGLQGKIPYRMDKRIREWCFGSFDGAYDGDLFMGIIPRIFNVDHVHQ
LSYAELAEGLVEVDTAGWAEGWEKLSGRIKEGFEMIAKEMEDQGGGNALVVSHGMTIGTI
VYLINGMHPHGLDNGSVTILEYEDGQFRVEVVGDRSYRELGREKMEEGSI
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagtacgattgtatttggtacgtcatggcaagaccatgtttaacacgattggt
cgcgcgcaaggttggagcgatactcccttaactgctgaaggtgaacgagggattcaagag
ttaggaatcggtttgcgagaatctgatctacagtttgagcgcgcttattcgagtgattct
ggtcgtaccattcagaccatgggaattatccttgaagagcttggcttgcaggggaaaatc
ccttatcgcatggacaagcgtatcagagaatggtgtttcggtagttttgatggagcctat
gatggcgatcttttcatgggcattattcctcgtatctttaatgtggaccacgttcaccaa
ttgtcttatgctgaactggctgagggcttggtagaggtcgatacagctggttgggctgaa
ggctgggaaaaactcagtggccgaattaaggaaggctttgaaatgattgcaaaagaaatg
gaagatcaaggtggaggtaacgcccttgttgtcagccatggaatgactattggaaccatt
gtttatctgattaatggcatgcatccgcatggtctagataatggtagcgtgacgattctt
gaatatgaggacggtcagtttagggttgaagttgtcggtgaccgtagttaccgagagcta
ggacgtgagaagatggaagaaggctctatttaa

DBGET integrated database retrieval system