KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0353Help
Entry
SPH_0353          CDS       T00658                                 

Definition
(GenBank) phosphoglycerate mutase family protein
Organism
spv  Streptococcus pneumoniae Hungary19A 6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
300239..300931
Genome map
AA seq 230 aa AA seqDB search
MVKVRLYLVRHGKTMFNTIGRAQGWSDTPLTAEGERGIQELGIGLRESDLQFERAYSSDS
GRTIQTMGIILEELGLQGKIPYRMDKRIREWCFGSFDGAYDGDLFMGIIPRIFNVDHVHQ
LSYAELAEGLVEVDTAGWAEGWEKLSGRIKEGFEMIAKEMEDQGGGNALVVSHGMTIGTI
VYLINGMHPHGLDNGSVTILEYEDGQFRVEVVGDRSYRELGREKMEEGSI
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagtacgattgtatttggtacgtcatggcaagaccatgtttaacacgattggt
cgcgcgcaaggttggagcgatactcccttaactgctgaaggtgaacgagggattcaagag
ttaggaatcggtttgcgagaatctgatctacagtttgagcgcgcttattcgagtgattct
ggtcgtaccattcagaccatgggaattatccttgaagagcttggcttgcaggggaaaatc
ccttatcgcatggacaagcgtatcagagaatggtgtttcggtagttttgatggagcctat
gatggcgatcttttcatgggcattattcctcgtatctttaatgtggaccacgttcaccaa
ttgtcttatgctgaactggctgagggcttggtagaggtcgatacagctggttgggctgaa
ggctgggaaaaactcagtggccgaattaaggaaggctttgaaatgattgcaaaagaaatg
gaagatcaaggtggaggtaacgcccttgttgtcagccatggaatgactattggaaccatt
gtttatctgattaatggcatgcatccgcatggtctagataatggtagcgtgacgattctt
gaatatgaggacggtcagtttagggttgaagttgtcggtgaccgtagttaccgagagcta
ggacgtgagaagatggaagaaggctctatttaa

DBGET integrated database retrieval system