KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0382Help
Entry
SPH_0382          CDS       T00658                                 

Definition
glycosy hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPH_0382
Enzymes [BR:spv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPH_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328548..329927
Genome map
AA seq 459 aa AA seqDB search
MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYYNGIGSDKTSTFYENW
ERDIELLLETGHTAFRTSIQWSRIFPQGCGKVNTQGVDFYRKVFEAIKAKGIRLLVNLYH
FDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWITFNEPIVPVEFGYFYDAH
YPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLNLTPAYPRSQHPADVKAAR
IAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEELELIRDNTVDFLGVNYYQPL
RVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSHRGWEIYEQGIYDIAQNIKENYGNIEW
MLTENGMGVEGEEKFRQDGMIQDDYRIDFVKGHLRELHRAIEDGANCKGYLIWTFIDCWS
WLNSYKNRYGLVELDLETQERRLKKSGHWFKKLSDNNGF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctaagatttccaaaggattttgtctggggatcctctacttctggaccgcagacagaa
ggacgtgtagctggtgacggtaagggagacaatctctgggattactggttccaagtggag
ccaaatcgttactataatgggattggttcagataagacatcgactttttatgaaaattgg
gagcgggatattgagcttttgttagagactggtcacacagcctttcggacttctattcag
tggtcacggatttttccacaaggctgtggaaaagtcaacactcaaggtgtggatttttat
cgtaaggtctttgaggctattaaggctaaaggaattcgtctgttagtcaatctctatcat
tttgatttaccttttgcccttcaagaggatggtgatggttgggaaaataaggcgacagtc
tcagcctatgaagactatgctcgtttttgttttgagacttatggagatttagtggatcaa
tggattacctttaacgagcccatcgttcctgtagaatttggttatttttatgatgcccat
tatccacataaggtggatgcagaggcagctgttaaggtagcctatcatacacaattggcc
agcagccgggctgttaaggcttgccatgaacttttgcctgattccaagattgggattgtc
ctcaacttgacaccggcttatccacgtagccagcatcctgctgatgtcaaggcagctcgt
attgcggccctttttcaggcccaatctttcttagatccatctgtcttggggacttatcca
caggagttggtagaaatcttgcatgaacacggtcttttacctgatgctacagaggaagag
ttggaactcattcgtgataatacggtggacttccttggtgtgaactactatcaacctttg
cgtgttatggctcctcgatttgctaagcatccagagagtccactcttaccagaacatttt
tacgagccttatgtgatgcctggacgtaaaatcaattctcaccgtggttgggagatttat
gagcaagggatttatgacatcgcccaaaatatcaaggaaaattatggcaatattgaatgg
atgttgactgagaatggtatgggtgttgaaggggaagaaaaattccgtcaagatggaatg
attcaagatgattaccgtattgactttgtaaaaggtcatcttcgtgaacttcaccgtgcc
attgaagatggtgccaactgtaagggctacttgatttggacctttattgactgctggtca
tggctcaacagctataaaaatcgctatggtttggtcgaattagacttggaaacgcaagaa
cgtcgtctgaagaaatcaggccactggttcaaaaaattaagcgataataatggattttaa

DBGET integrated database retrieval system