KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0406Help
Entry
SPH_0406          CDS       T00658                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
358746..359726
Genome map
AA seq 326 aa AA seqDB search
MVKSLEGVTDMSTKVNHAKTAICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASML
DIGGESTRPGSSYVEIEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGADL
VNDITGLMGDEKMAHVVAEARAQVVIMFNPVMARPQHPSSLIFPHFGFGQAFTEEELADF
ETLPIEELMEAFFERALARAAEAGIAPENILLDPGIGFGLTKKENLLLLRDLDKLHQKGY
PIFLGVSRKRFVINILEEIGFEVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVAS
HRMAVEIASAIRLADEAENLDLKQYK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaagccttgagggagtgaccgatatgtcaactaaagtaaatcatgcaaagaca
gctatttgcggaattatcaatgtaaccccagattccttttcggatggtggtcaatttttt
gctcttgagcaggcactccagcaggctcgtaaattgatagcagaaggggctagtatgcta
gatatcggcggagaatcgactcggccgggaagtagctatgttgagatagaaatagaagag
gaaatccagcgtgttgttccagtgattaaagcgattcgcaaggaaagtgatgtcctcatc
tctattgatacttggaagagtcaagtagcagaggctgctttggctgctggtgccgatcta
gtcaatgatatcactggtcttatgggtgatgagaaaatggctcatgtggtagctgaagcg
agagcgcaagtggtcatcatgtttaatccagttatggcgcgacctcagcaccctagctcg
ctcatcttccctcattttggttttggtcaagcttttacagaggaagagttagctgacttt
gaaacattgccaatcgaagaattgatggaggctttctttgaacgagcactagcgagagcg
gcagaagctggtattgcaccagaaaatatcctgttggatccaggaattggctttggtctg
accaagaaagaaaatctgcttcttttacgggacctggataaactacatcagaagggctat
ccaatctttctcggagtgtcgcgcaagcgatttgtcatcaatatccttgaagaaattggg
tttgaagtcaatcctgagacagagcttggtttccgcaatcgggacacggcttcggctcat
gtaaccagtatcgctgcgagacagggtgtagaagtggtgcgcgtgcatgacgtagctagt
cacaggatggcagttgaaattgcctctgccattcgtctggctgatgaagcggaaaattta
gatttaaaacaatataaataa

DBGET integrated database retrieval system