KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0408Help
Entry
SPH_0408          CDS       T00658                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
361031..361585
Genome map
AA seq 184 aa AA seqDB search
MDTQKIEAAVKMIIEAVGENANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID
DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLN
IEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYR
LMGL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacacaaaagattgaagcagctgtaaaaatgattatcgaggctgtaggagagaac
gctaatcgcgagggcttgcaggaaacacctgctcgtgtagcccgtatgtatcaagagatt
ttttcaggtcttggtcaaacagcagaggaacatttgtcaaaatcctttgaaattattgac
gataatatggtggtagaaaaggatatctttttccataccatgtgtgaacaccacttcttg
ccattttatggtagagcgcacattgcctacattccagatggtcgtgtggcaggcttgtct
aagctagcccgtacggttgaagtttattcgaaaaaaccacaaattcaagaacgtttgaat
atcgaagtggccgatgccttgatggactatctaggtgctaaaggagcctttgttgtcatt
gaggcggaacatatgtgtatgagtatgcgtggtgttagaaaaccaggcactgcaaccttg
acgacagtagctcgtggtctatttgaaacagataaggacctccgcgaccaagcttatcgt
ttaatggggctataa

DBGET integrated database retrieval system