KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0409Help
Entry
SPH_0409          CDS       T00658                                 

Definition
bifunctional folate synthesis protein (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPH_0409
Enzymes [BR:spv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SPH_0409
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     SPH_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
361628..362440
Genome map
AA seq 270 aa AA seqDB search
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPWGGVEQDSFTNQVVEVET
WLPAQVLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQTLYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatcaactgcagattaaggatttggaaatgtttgcctatcatggtctttttcctagt
gagaaagaattggggcagaaatttgtcgtttcagccatcctatcctatgatatgaccaag
gcagctacagacttggatttaacagcctctgtccattacggagaattgtgtcagcagtgg
acgacttggtttcaggaaacgagtgaagatttgattgaaacggtagcctataaactggtg
gaacgtacctttgagtcttatcctcttgtccaagaaatgaagttggaactgaaaaaacct
tgggcaccggtgcatttgtcactagatacttgctcggtaaccattcatcgccgcaagcaa
cgagcctttatcgccctaggaagcaatatgggagataaacaagcaaacttgaagcaagcc
attgacaaactgcgagctcgtggcatccatattctcaaagagtccagtgtcttagcgacg
gagccttggggtggtgttgagcaggatagctttaccaatcaagtggttgaagtagaaaca
tggttgcctgcccaagtgctattagaaaccttgttagccattgagtcagagctgggacgg
gtgagagaagtgcattggggccctcgtttgattgatttggacttgctctttgtggaggac
cagaccctttatacagacgacctcatattgcctcatccttacatagcggaacgccttttt
gtccttgagtccttacaggaaattgcgcctcattttatccatccgatattaaaacaaccg
atccgcaacttgtatgatgctttgaaaaaatag

DBGET integrated database retrieval system