KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0425Help
Entry
SPH_0425          CDS       T00658                                 

Definition
peroxiredoxin Hyr1 (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SPH_0425
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPH_0425
Enzymes [BR:spv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPH_0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(374904..375380)
Genome map
AA seq 158 aa AA seqDB search
MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGLQELYERYQDQGFEIL
DFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKEADPLYVWLKDQKSGPLGK
RVEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactttatgatttttccgttttgaaccaaaacaaccaagcaactcccttggat
agctatcgtggcaaagttctcttgattgtcaacactgctactggatgtggtttaacgccc
cagtaccagggacttcaagaactctatgaacgctatcaagatcagggctttgaaatattg
gatttcccttgcaatcagtttatgggacaagcacccggcagcgcagaggaaatcaacgcc
ttctgtagcctacattttcaaaccaccttcccacgttttgccaagattaaggtcaacggt
aaggaagcagaccctctctatgtctggttaaaagaccagaaatccggcccactaggaaaa
cgagtcgaatggaatttcgctaagtttctcatcggtcgagatgggcaagtctttgaacgc
ttttcttcaaaaacagacccaaaacaaattgaagaggcgatacaaactctactataa

DBGET integrated database retrieval system