KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0467Help
Entry
SPH_0467          CDS       T00658                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:spv00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:spv00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
417278..417871
Genome map
AA seq 197 aa AA seqDB search
MSDNFFGKTLVVRKIDAIPGLLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAAGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADDGKVLGSWVDLREGETFGNVYQTEIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPALGIEWENLAEAEVSEAD
KHHPLLRDVKPLTKDEL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataatttttttggaaagacacttgtggtacgcaagattgatgctataccagga
ctgctagagtttgatattcccgttcatggagacaatcgtggttggtttaaggaaaatttc
cagaaggaaaagatgctaccgcttggttttcctgaaagcttctttgctgcagggaaactg
caaaataacgtcagcttttctcgcaaaaatgttcttcgaggactccatgctgaaccttgg
gacaagtatatctctgttgcagacgatgggaaggttttaggatcttgggtagatttgcgt
gaaggcgagacctttggaaatgtttaccagacagagattgatgctagcaagggaattttt
gtccctcgtggcgtagccaacggttttcaagtcctctcagatacagtttcctatagctat
ctggtcaatgactactgggctcttgaactcaaacccaaatatgcctttgttaactatgct
gacccagcattgggaattgagtgggaaaacctagcggaagctgaggtttcagaggcagac
aaacaccatcctctattaagggatgtcaaaccacttacgaaagacgagttgtaa

DBGET integrated database retrieval system