KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_0741Help
Entry
SPH_0741          CDS       T00658                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spv00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:spv00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:spv00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
690025..696726
Genome map
AA seq 2233 aa AA seqDB search
MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYADETLITHTAEKPKEE
KMIVEEKADKALETKNVVERTEQSEPSSTEAIASEKKEDEAVTPKEEKVSAKLEEKAPRI
ESQASSQEKPLKEDAKAVTNEEMNQMIEDRKVDFNQNWYFKLNANSKEAIKPDADVSTWK
KLDLPYDWSIFNDFDHESPAQNEGGQLNGGEAWYRKTFKLDEKDLKKNVRLTFDGVYMDS
QVYVNGQLVGHYPNGYNQFSYDITKYLHKDGRENVIAVHAVNKQPSSRWYSGSGIYRDVT
LQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIVNTDDKDHELVAEYQIVERGGHA
VTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKPALYELITRVYRDGQLVDAKKD
LFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGAEENYKAEYRRLKQMKEMGVNSI
RTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPYDYGRFFEKDATHPEARKGEKWSD
FDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLATVKRLVKVIKDVDKTRYVTMGADK
FRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAKHPKWLIYGSETSSATRTRGSYYRPE
RELKHSNGPERNYEQSDYGNDRVGWGKTATASWTFDRDNAGYAGQFIWTGTDYIGEPTPW
HNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQWVSVKKKPMVHLLPHWNWENKELASKVA
DSEGKIPVRAYSNASSVELFLNGKSLGLKTFNKKQTSDGRTYQEGANANELYLEWKVAYQ
PGTLEAIARDESGKEIARDKITTAGKPAAVRLIKEDHAIAADGKDLTYIYYEIVDSQGNV
VPTANNLVRFQLHGQGQLVGVDNGEQASRERYKAQADGSWIRKAFNGKGVAIVKSTEQAG
KFTLTAHSDLLKSNQVTVFTGKKEGQEKTVLGTEVPKVQTIIGEAPEMPTTVPFVYSDGS
RAERPVTWSSVDVSKPGIVTVKGMADGREVEARVEVIALKSELPVVKRIAPNTDLNSVDK
SVSYVLTDGSVEEYEVDKWEIAEEDKAKLAIPGSRIQATGYLEGQPIHATFVVEEGNPAA
PAVPTVTVGGEAVTGLTSQKPMQYRTLAYGAKLPEVTASAKNAAVTVLQASAANGMRASI
FVQPNDGGPLQTYAIQFLEEAPKIAHLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLP
ADKVTFSTSGEGEVVVRKGMLELHKPGAVTLNAEYEGATGQITLTIQANTEKKIAQSIRP
VNVVTDLHQEPSLPATVTVEYDKGFPKTHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEA
RAKVSVEGIVSVEEVSVTTPIAEAPQLPESVRTYDSNGHVSSANIAWDAIRTEQYAKEGV
FTVNGRLEGTQLTTKLHVRVSAQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKL
ISYNNQPANRWTNWNRSNPEASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGVPKSYVIE
YYVGKTVPTAPKNPNFVGNEDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAV
RIRMVKADNKRGTSITEVQIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGK
VPAVTASVSNNGLATVVPSVREGEPVRVIAKAENGDILGEYRLHFTKDKNLLSHKPVAAV
KQARLLQVGQALELPTKVPVYFTGKDGYETKDLTVEWEEVPAENLTKAGQFTVRGRVLGS
NLVAEVTVRVTDKLGETLSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRR
WTNWSARPSTNPEVSAGVIFRENGKIVERTVGQGKVQFFADSGTDAPSKLVLERYVGPEF
EVPTYYSNYQAYDADHPFNNPENWEAVPYRADKDIEAGDEINVTFKAVKAKAMRWRMERK
ADKSGVAMIEMTFLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEE
NNQVASTVVDSGEDSLPVLVRLVSESGKQVKEYRIQLTKEKPVSEKTVAAVQEDLPKLEF
VEKDLAYKTVEKKDSTLYLGETRVEQEGKTGKERIFTAINPDGSKEEKLREVVEAPTDRI
VLVGTKPVAQEAKKPQVSEKADTKPIDSSEASQTNKAQLPNTGSAASQAAVAAGLALLGL
SAGLVVTKGKKED
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggccattggaatcggaaaagagtttatagcattcgtaagtttgctgtggga
gcttgctcagtaatgattgggacttgtgcagttctattaggaggaaatatagctggagaa
tctgtagtttatgcggatgaaacacttattactcatactgctgagaaacctaaagaggaa
aaaatgatagtagaagaaaaggctgataaagctttggaaactaaaaatgtagttgaaagg
acagaacaaagtgaacctagttcaactgaggctattgcatctgagaagaaagaagatgaa
gccgtaactccaaaagaggaaaaagtgtctgctaaactggaagaaaaagctccaaggata
gaatcacaagcttcaagtcaagaaaaaccgctcaaggaagatgctaaagctgtaacaaat
gaagaaatgaatcaaatgattgaagacaggaaagtggattttaatcaaaattggtacttt
aaactcaatgcaaattctaaggaagccattaaacctgatgcagacgtatctacgtggaaa
aaattagatttaccgtatgactggagtatctttaacgatttcgatcatgaatctcctgca
caaaatgaaggtggacagctcaacggtggggaagcttggtatcgcaagactttcaaacta
gatgaaaaagacctcaagaaaaatgttcgccttacttttgatggcgtctacatggattct
caagtttatgtcaatggtcagttagtggggcattatccaaatggttataaccagttctca
tatgatatcaccaaataccttcacaaagatggtcgtgagaatgtgattgctgtccatgca
gtcaacaaacagccaagtagccgttggtattcaggaagtggtatctatcgtgatgtgact
ttacaagtgacagataaggtgcatgttgagaaaaatgggacaactattttaacaccaaaa
cttgaagaacaacaacatggcaaggttgaaactcatgtgaccagcaaaatcgtcaatacg
gacgacaaagaccatgaacttgtagccgaatatcaaatcgttgaacgaggtggtcatgct
gtaacaggcttagttcgtacagcgagtcgtactttaaaagcacatgaatcaacaagccta
gatgcgattttagaagttgaaagaccaaaactctggaccgttttaaatgacaaacctgcc
ttgtacgaattgattacgcgtgtttaccgtgacggtcaattggttgatgctaagaaggat
ttgtttggttaccgttactatcactggactccaaatgaaggtttctctttgaatggtgaa
cgtattaaattccatggagtatccttgcaccacgaccatggggcgcttggagcagaagaa
aattataaagcagaataccgtcgtctcaaacaaatgaaggagatgggagttaactccatc
cgtacaacccacaaccctgctagtgagcaaaccttgcaaatcgcagcagaactaggttta
ctcgttcaggaagaggcctttgatacttggtatggtggcaagaaaccttatgactatgga
cgtttctttgaaaaagatgccactcacccagaagctcgaaaaggtgaaaaatggtctgat
tttgacctacgtaccatggtcgaaagaggcaaaaacaaccctgctatcttcatgtggtca
attggtaatgaaataggtgaagctaatggtgatgcccactctttagcaactgttaaacgt
ttggtcaaggttatcaaggatgttgataagactcgctatgttaccatgggagcagataaa
ttccgtttcggtaatggtagcggagggcatgagaaaattgctgatgaactcgatgctgtt
ggatttaactattctgaagataattacaaagcccttagagctaagcatccaaaatggttg
atttacggttcagaaacatcatcagcaacccgtacacgaggaagttactatcgccctgaa
cgtgaattgaaacatagcaatggacctgagcgtaattatgaacagtcagattatggaaat
gatcgtgtgggttgggggaaaacagcaaccgcttcatggacttttgaccgtgacaacgct
ggctatgctggacagtttatctggacaggtacggactatattggtgaacctacaccatgg
cacaaccaaaatcaaactcctgttaagagctcttactttggtatcgtagatacagccggc
attccaaaacatgacttctatctctaccaaagccaatgggtttctgttaagaagaaaccg
atggtacaccttcttcctcactggaactgggaaaacaaagaattagcatccaaagtagct
gactcagaaggtaagattccagttcgtgcttattcgaatgcttctagtgtagaattgttc
ttgaatggaaaatctcttggtcttaagactttcaataaaaaacaaaccagcgatgggcgg
acttaccaagaaggtgcaaatgctaatgaactttatcttgaatggaaagttgcctatcaa
ccaggtaccttggaagcaattgctcgtgatgaatctggcaaggaaattgctcgagataag
attacgactgctggtaagccagcggcagttcgtcttattaaggaagaccatgcgattgca
gcagatggaaaagacttgacttacatctactatgaaattgttgacagccaggggaatgtg
gttccaactgctaataatctggttcgcttccaattgcatggccaaggtcaactggtcggt
gtagataacggagaacaagccagccgtgaacgctataaggcgcaagcagatggttcttgg
attcgtaaagcatttaatggtaaaggtgttgccattgtcaaatcaactgaacaagcaggg
aaattcacccttactgcccactctgatctcttgaaatcgaaccaagtcactgtctttact
ggtaagaaagaaggacaagagaagactgttttggggacagaagtgccaaaagtacagacc
attattggagaggcacctgaaatgcctaccactgttccgtttgtatacagtgatggtagc
cgtgcagaacgtcctgtaacctggtcttcagtagatgtgagcaagcctggtattgtaacg
gtgaaaggtatggctgacggacgagaagtagaagctcgtgtagaagtgattgctcttaaa
tcagagctaccagttgtgaaacgtattgctccaaatactgacttgaattctgtagacaaa
tctgtttcctatgttttgactgatggaagtgttgaagagtatgaagtggacaagtgggag
attgccgaagaagataaagctaagttagcaattccaggttctcgtattcaagcgaccggt
tatttagaaggtcaaccaattcatgcaacctttgtggtagaagaaggcaatcctgcggca
cctgcagtaccaactgtaacggttggtggtgaagctgtcacaggtcttactagtcaaaaa
ccaatgcaataccgcactcttgcttatggagctaagttgccagaagtcacagcaagtgct
aaaaatgcagctgttacagttcttcaagcaagcgcagcaaacggcatgcgtgcaagcata
tttgttcaaccaaatgatggtggccctcttcaaacctatgcaattcaattcctagaagaa
gcgccaaaaattgcccatttgagcctacaagtggaaaaagctgacagtctcaaagaagac
caaactgtcaaattgtcggttcgagctcactatcaagatggaacgcaagctgtattacca
gctgataaagtaaccttctctacaagtggtgaaggggaagttgtagtccgaaaaggaatg
cttgagttgcataagccaggagcagtcactctgaacgctgaatatgagggtgctacaggt
caaatcactctcactatccaagccaatactgagaagaagattgcgcaatccatccgtcct
gtaaatgtagtgacagatttgcatcaggaaccaagtcttccagcaacagtaacagttgag
tatgacaaaggtttccctaaaactcataaagtcacttggcaagctattccgaaagaaaaa
ctagactcctatcaaacatttgaagtactaggtaaagttgaaggaattgaccttgaagcg
cgtgcaaaagtctctgtagaaggtatcgtttcagttgaagaagtcagtgtgacaactcca
atcgcagaagcaccacaattaccagaaagcgttcggacatatgattcaaatggtcatgtt
tcatcagctaatattgcatgggatgcgattcgtacagagcaatacgctaaggaaggtgtc
tttacagttaatggtcgcttagaaggtactcaattaacaactaaacttcatgttcgcgta
tctgctcaaactgagcaaggtgcaaacatttctgaccaatggaccggttcagaattgcca
cttgcctttgcttcagattcaaatccaagcgacccagtttcaaatgttaatgacaagctc
atttcctacaataaccaaccagccaatcgttggacaaactggaatcgtagtaatccagaa
gcttcagtcggtgttctgtttggagattcaggtatcttgagcaaacgctccgttgataat
ctaagtgtcggattccacgaagaccatggagttggtgtaccgaagtcttatgtgattgag
tattatgttggtaagactgtcccaacagctcctaaaaaccctaattttgttggtaatgag
gaccatgtctttaatgattctgccaactggaaaccagttactaatctaaaagcccctgct
caactcaaggctggagaaatgaaccactttagctttgataaagttgaaacctatgctgtt
cgtattcgcatggttaaagcagataacaagcgtggaacgtctatcacagaggtacaaatc
tttgcgaaacaagttgcggcagccaaacaaggacaaacaagaatccaagttgacggtaaa
gacttagcaaacttcaaccctgatttgacagactactaccttgagtctgtagatggaaaa
gttccggcagtcacagcaagtgttagcaacaatggtctcgctaccgtcgttccaagcgtt
cgtgaaggtgagccagttcgtgtcatcgcgaaagctgaaaatggcgacatcttaggagaa
taccgtctgcacttcactaaggataagaacttactttctcataaaccagttgctgcggtt
aaacaagctcgcttgctacaagtaggtcaagcacttgaattgccgactaaggttccagtt
tacttcacaggtaaagacggctacgaaacaaaagacctgacagttgaatgggaagaagtt
ccagcggaaaatctgacaaaagcaggtcaatttactgttcgaggccgtgtccttggtagt
aaccttgttgctgaggtcactgtacgagtgacagacaaacttggtgagactctttcagat
aaccctaactatgatgaaaacagtaaccaggcctttgcttcagcaaccaatgatattgac
aaaaactctcatgaccgcgttgactatctcaatgacggagatcattcagaaaatcgtcgt
tggacaaactggtctgcaagaccgtctaccaatccagaagtatcagcaggcgtaatcttc
cgtgaaaatggtaagattgtagaacggactgttggacaaggaaaagttcagttctttgca
gatagtggtacggatgcaccatctaaactcgttttagaacgctatgtcggtccagagttt
gaagtgccaacctactattcaaactaccaagcctacgacgcagaccatccattcaacaat
ccagaaaattgggaagctgtgccttatcgtgcggataaagacattgaagccggtgatgaa
attaacgttacctttaaagctgtcaaagccaaagccatgagatggcgtatggagcgtaaa
gcagataagagcggtgttgcgatgattgagatgaccttccttgcaccaagtgaattgcct
caagaaagcacgcaatcgaagattcttgtagatggaaaagaacttgctgatttcgctgaa
aatcgtcaagactatcaaattacctataaaggtcaacggccaaaagtctcagttgaagaa
aacaatcaagtagcttcaactgtggtagatagtggagaagatagccttccagtacttgtt
cgcctcgtttcagaaagtggaaaacaagttaaggaataccgtatccagttgactaaggaa
aaaccagtttctgagaagacagttgctgctgtacaagaagatcttccaaaactcgaattt
gttgaaaaagatttggcctacaagacagttgagaaaaaagattcaacactgtatctaggt
gaaactcgtgtagaacaagaaggaaaaactggtaaagaacgtatctttacagcgattaat
cctgatggaagtaaggaagaaaaactccgtgaagtggtagaagctccgacagaccgcatc
gtcttggttggaaccaaaccagtagctcaagaagctaaaaaaccacaagtgtcagaaaaa
gcagatacaaaaccaattgattcaagtgaagctagtcaaactaataaagcccagttacca
aatacaggtagtgcggcaagccaagcagcagtagcagcaggtttagctcttctaggtttg
agtgcaggattagtagttactaaaggtaaaaaagaagactag

DBGET integrated database retrieval system