KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_1688Help
Entry
SPH_1688          CDS       T00658                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
spv00010  Glycolysis / Gluconeogenesis
spv00051  Fructose and mannose metabolism
spv00562  Inositol phosphate metabolism
spv01100  Metabolic pathways
spv01110  Biosynthesis of secondary metabolites
spv01120  Microbial metabolism in diverse environments
spv01130  Biosynthesis of antibiotics
spv01200  Carbon metabolism
spv01230  Biosynthesis of amino acids
Module
spv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPH_1688 (tpiA)
   00051 Fructose and mannose metabolism
    SPH_1688 (tpiA)
   00562 Inositol phosphate metabolism
    SPH_1688 (tpiA)
Enzymes [BR:spv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPH_1688 (tpiA)
Exosome [BR:spv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPH_1688 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPH_1688 (tpiA)
  Exosomal proteins of melanoma cells
   SPH_1688 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACA36865
UniProt: B1ICZ4
Structure
PDB: 

Jmol
Position
complement(1557569..1558327)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgcatcaaaacttccttcatcagatcttgttgaagcaggt
atcgctgctccagctcttgatttgacaactgttcttgctgttgcaaaaggctcgaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgattacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgacgaagatatcaacaaaaaagcaaaagcaatctttgcgaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcctcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagtcgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaatgtt
gcttcatacatggcttgcccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system