KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_1847Help
Entry
SPH_1847          CDS       T00658                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
spv00230  Purine metabolism
spv01100  Metabolic pathways
Module
spv_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPH_1847 (gmk)
Enzymes [BR:spv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SPH_1847 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 AAA_22 RsgA_GTPase AAA NB-ARC
Motif
Other DBs
NCBI-ProteinID: ACA36950
UniProt: B1I7K1
Position
complement(1709574..1710200)
Genome map
AA seq 208 aa AA seqDB search
MADRGLLIVFSGPSGVGKGTVRREIFESSENQFQYSVSMTTRAQRPGEVDGVDYFFRTRE
EFEELIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVF
IFLTPPDLDELQDRLVGRGTDSAEVIAQRIEKAKEEIALMREYDYAIVNDQVPLAAERVK
CVIEAEHFCVDRVIGHYQEMLPKSPTTR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccgaggcttactaatcgttttttctggtccttcaggggttggaaaaggaacg
gttagaagagagatttttgagagttctgaaaaccaatttcaatattctgtatcgatgacg
acacgcgcacaacgtcctggagaagtggacggtgttgactatttcttccgtactcgtgaa
gaatttgaagagctgattcgtcaaggacagatgttggaatacgcagaatatgtcggcaac
tactatggaactcctctgacctatgtcaatgaaaccttggacaagggaatcgatgttttc
cttgaaattgaagttcagggtgctcttcaggtcaagaaaaaggttccagatgctgtcttt
atcttcctgacaccaccagatttggatgaattgcaagatcgcttggtaggtcgtggaaca
gatagtgcagaagtgattgcccaacgaatcgaaaaggccaaggaagaaattgccctcatg
cgtgagtatgattatgcgattgtcaacgatcaggtgcccctagctgctgaacgtgtcaaa
tgtgtgattgaagcagaacacttctgtgtggatcgtgtcattggtcactatcaggagatg
ttaccaaaatctccaactacccgataa

DBGET integrated database retrieval system