KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_1932Help
Entry
SPH_1932          CDS       T00658                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
spv00260  Glycine, serine and threonine metabolism
spv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spv01100  Metabolic pathways
spv01110  Biosynthesis of secondary metabolites
spv01130  Biosynthesis of antibiotics
spv01230  Biosynthesis of amino acids
Module
spv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPH_1932 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPH_1932 (trpA)
Enzymes [BR:spv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPH_1932 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA
Motif
Other DBs
NCBI-ProteinID: ACA35528
UniProt: B1I7S6
Structure
PDB: 

Jmol
Position
complement(1795868..1796644)
Genome map
AA seq 258 aa AA seqDB search
MPKTLTEKLNAIKAAGKGIFVPYIMAGDHEKGLDGLAETIHFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTSTQALVETLKTIETEIPLVIMTYFNPLFQYGVENFVKDLAD
TAVKGLIIPDLPHEHANFVEPFLADTDIALIPLVSLTTGIERQKELIEGAEGFIYAVAIN
GVTGKSGNYRADLDKHLAQLHQVADIPVLTGFGVSSQADLERFNAVSDGVIVGSKIVKAL
HQGEPIQDFIKQAVAYQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagacactaacagaaaaattgaatgctattaaagcagctggaaaaggaattttt
gttccctatatcatggctggtgaccacgagaaaggtttggacggtcttgctgaaacaatt
cactttttagaagatttgggtgtctctgcaattgaagtgggtattcccttttcagaccct
gttgcagatggacctgttatcgaagaagctggcttgcgcagtttagcccacgggacctct
acccaggctttagttgaaaccttgaaaaccattgaaacagagattccactggtcatcatg
acctacttcaaccccctctttcagtacggtgtggagaactttgtcaaagatctggctgat
acagctgtgaagggcttgattatcccagacttgcctcatgaacatgccaactttgtagaa
ccatttttggcagatacagatatcgccttgattcctttagtaagcttgaccacaggaatt
gagcgccagaaagagttgattgaaggggcggagggattcatctatgccgttgccatcaat
ggagtgacagggaaatcaggcaattaccgtgcagatttggacaagcacttggcgcaactt
catcaagtggccgacatcccagtcttgacaggttttggtgtatctagtcaagccgatctg
gaacgcttcaatgcggtgtcagatggtgttatcgtcggttcgaaaatagtaaaagctctc
caccaaggagagccgattcaggactttatcaaacaagcagtagcttaccaaaaataa

DBGET integrated database retrieval system