KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_1936Help
Entry
SPH_1936          CDS       T00658                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:spv01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:spv00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1798424..1799191)
Genome map
AA seq 255 aa AA seqDB search
MSQEFLARILEQKAREVEQMKLEQIQPLRQTYRLAEFLKNHQDRLQVIAEVKKASPSLGD
INLDVDIVQQAQTYEENGAVMISVLTDEVFFKGHLDYLREISSQVEIPTLNKDFIIDEKQ
IIRARNAGATVILLIVAALAEERLKELYDYATVLGLEVLVETHNLAELEVAHRLGAQIIG
VNNRNLTTFEVDLQTSVDLAKHFKDDCLYISESAIFTRQDAERLAPYFNGILVGTALMQA
ENVVQRIKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatttttagcacgaatcttagagcagaaggcgcgtgaggtggagcagatg
aagctggagcaaatccagcctctgcgccagacctatcgcttggcagaatttttgaagaat
catcaggaccgcttgcaggtaatcgctgaggtcaagaaagctagccctagtttgggagat
atcaatctcgatgtggatattgtgcaacaggcccagacttatgaagaaaacggagcagtg
atgatttcggtgttgacagatgaagttttctttaaaggacatttggattatctacgggag
atttccagtcaggtagagattccgacgctcaacaaggactttatcatcgatgaaaagcaa
atcatccgcgctcgcaatgcaggtgcgacagtcatcttgctcattgtggcagccttggca
gaagaacgtcttaaggaactttacgactacgcgacagtgcttggtctggaagtcttggtg
gaaactcacaatctagctgaactagaagtggctcacagacttggtgcccagattatcggg
gtcaataaccgcaacttgaccacctttgaggtcgacttgcagaccagtgtagacttggct
aaacatttcaaagatgattgcttgtacatttctgaatctgctattttcacaaggcaggat
gcggaacgactagccccatactttaacggaattttggtagggacagctcttatgcaggca
gaaaatgtggtccagagaatcaaggagttgcagattgacaaaggttaa

DBGET integrated database retrieval system