KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_2108Help
Entry
SPH_2108          CDS       T00658                                 

Gene name
murA2
Definition
(RefSeq) UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
  KO
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPH_2108 (murA2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPH_2108 (murA2)
Enzymes [BR:spv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SPH_2108 (murA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1945903..1947186)
Genome map
AA seq 427 aa AA seqDB search
MDKIVVQGGDNRLVGSVTIEGAKNAVLPLLAATILASEGKTVLQNVPILSDVFIMNQVVG
GLNAKVDFDEEAHLVKVDATGDITEEAPYKYVSKMRASIVVLGPILARVGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGVKISQTAGYIEAKAERLHGAHIYMDFPSVGATQNLMMAATLA
DGVTVIENAAREPEIVDLAILLNEMGAKVKGAGTETITITGVEKLHGTTHNVVQDRIEAG
TFMVAAAMTGGDVLIRDAVWEHNRPLIAKLLEMGVEVIEEDEGIRVRSQLENLKAVHVKT
LPHPGFPTDMQAQFTALMTVAKGESTMVETVFENRFQHLEEMRRMGLHSEIIRDTARIVG
GQPLQGAEVLSTDLRASAALILTGLVAQGETVVGKLVHLDRGYYGFHEKLAQLGAKIQRI
EASDEDE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattgtggttcaaggtggcgataatcgtctggtaggaagcgtgacgatcgag
ggagcaaaaaatgcagtcttacccttgttggcagcgactattctagcaagtgaaggaaag
accgtcttgcagaatgttccgattttgtcggatgtctttattatgaatcaggtagttggt
ggtttgaatgccaaggttgactttgatgaggaagctcatcttgtcaaggtggatgctact
ggcgacatcactgaggaagccccttacaagtatgtcagtaagatgcgcgcctccatcgtt
gtattagggccaatccttgcccgtgtgggtcatgccaaggtatccatgccaggtggttgt
acgattggtagccgtcctattgatcttcatttgaaaggtctggaagctatgggggttaag
attagtcagacagctggttacatcgaagccaaggcagaacgcttgcatggtgctcatatc
tatatggactttccaagtgttggtgcaacgcagaacttgatgatggcagcgactctggct
gatggggtgacagtgattgagaatgctgcgcgtgagcctgagattgttgacttagccatt
ctccttaatgaaatgggagccaaggtcaaaggtgctggtacagagactataaccattact
ggtgttgagaaacttcatggtacgactcacaatgtagtccaggaccgtatcgaagcagga
acctttatggtagctgctgccatgactggtggtgatgtcttgattcgagacgctgtctgg
gagcacaaccgtcccttgattgccaagttacttgaaatgggtgttgaagtaattgaagaa
gacgaaggaattcgtgttcgttctcaactggaaaatctaaaagctgttcatgtgaaaacc
ttgccccacccaggatttccaacagatatgcaggctcaatttacagccttgatgacagtt
gcaaaaggcgaatcaaccatggtggagacagtttttgaaaatcgtttccaacacctagaa
gagatgcgccgcatgggcttgcattctgagattatccgtgatacagctcgtattgttggt
ggacagcctttgcagggagcagaagttctttcaactgaccttcgtgccagtgcagctttg
attttgacaggtttggtagcacagggagaaactgtggtcggtaaattggttcacttggat
agaggttactacggtttccatgagaagttggcgcagctaggtgctaagattcagcggatt
gaggcaagtgatgaagatgaataa

DBGET integrated database retrieval system