KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_2179Help
Entry
SPH_2179          CDS       T00658                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPH_2179
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPH_2179
   00620 Pyruvate metabolism
    SPH_2179
   00650 Butanoate metabolism
    SPH_2179
  Lipid metabolism
   00071 Fatty acid degradation
    SPH_2179
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPH_2179
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPH_2179
   00626 Naphthalene degradation
    SPH_2179
Enzymes [BR:spv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPH_2179
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SPH_2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2003546..2006197)
Genome map
AA seq 883 aa AA seqDB search
MADKKTVTPEEKKLVAEKHVDELVQKALVALEEMRKLDQEQVDYIVAKASVAALDAHGEL
ALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQW
ITQPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLTREKLSPV
IAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFER
DSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTV
NRGTEIMRAFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPL
LGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
VAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKMHNAS
TIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERIGIQMNFRDQGIDEKEWKEHSR
ELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtgacaccagaggaaaagaaactcgttgctgaaaaacacgta
gatgagttggttcaaaaagctctagttgcccttgaagaaatgcgtaaattggatcaagag
caagttgactacatcgttgccaaagcatcagtagcagctttggatgcccacggagaattg
gctttacatgcctttgaagaaacaggacgtggtgtatttgaagacaaagcaactaagaac
ttgtttgcctgtgaacacgtagtaaacaacatgcgccacactaagacagttggcgttatc
gaagaagacgatgtaacaggattgactcttattgctgaaccagttggtgttgtttgtggt
attactccaacaacaaacccaacatcaacagcaattttcaaatcattgatttcattgaag
acacgtaacccaatcgtctttgccttccatccatcagcacaagaatcatctgctcatgca
gctcgtatcgtccgcgatgcagctatcgcagctggtgctcctgaaaactgtgtgcaatgg
attactcaaccatctatggaagcaacaagtgcccttatgaaccacgaaggggttgcgaca
atccttgcaacaggtggtaatgccatggttaaggcggcttattcatgtggtaaaccagct
cttggggtaggtgccggaaacgttccagcttatgttgaaaaatcagcaaacattcgtcaa
gcagcacacgatatcgtcatgtctaaatcatttgataacggtatggtctgtgcatctgaa
caagcagttatcattgataaagaaatttacgatgaatttgtagcagagttcaaatcttac
cacacttactttgtaaacaaaaaagaaaaagctcttcttgaagagttctgcttcggcgtc
aaagcaaacagcaaaaactgtgctggtgcaaaattgaacgctgacatcgttggtaaacca
gcaacttggattgcagaacaagcaggatttacagttccagaaggaacaaacattcttgct
gcagaatgtaaagaagttggcgaaaatgagccattgactcgtgaaaaattgtcaccagtt
attgcagttttgaaatctgaaagccgtgaagatggtattactaaggctcgtcaaatggtt
gaatttaacggtcttggacactcagcagctatccacacagctgacgaagaattgactaaa
gaatttggtaaagctgttaaagctattcgtgttatctgtaactcaccttctacttttggt
ggtatcggggacgtttacaatgccttcttgccatcattgacacttggatgtggttcttac
ggacgcaactcagttggggataacgttagtgccattaacctcttgaatatcaaaaaagtc
ggaagacggagaaataacatgcaatggatgaaacttccttcaaaaacatactttgaacgt
gattcaattcaataccttcaaaaatgtcgtgacgttgaacgtgtcatgatcgttactgac
catgccatggtagagcttggtttccttgatcgtatcatcgaacaactggaccttcgtcgc
aataaggttgtttaccaaatctttgcggatgtagaaccggatccagatatcacaactgta
aaccgtggtactgagattatgcgtgccttcaaaccagataccatcatcgcactcggtggt
gggtctccaatggatgctgccaaagtaatgtggctcttctacgagcaaccagaagtggac
ttccgtgaccttgtccaaaaattcatggatatccgtaaacgtgccttcaagttcccattg
cttggtaagaagactaaattcatcgcgattccaactacatctggtacaggatctgaagta
acaccatttgccgttatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaatcgtagatcctgctttggtattgacagttccaggattt
gttgctgctgatactggtatggacgtattgactcacgcgacagaagcatacgtatcacaa
atggctagtgactacactgatggtttagcacttcaagccattaaattggtctttgaaaat
ctcgaaagctcagttaagaatgcagacttccactcacgtgagaaaatgcataacgcttca
acaatcgctggtatggcctttgccaatgccttcctaggtatttctcactcaatggcccat
aagattggtgcgcaattccacacaatccacggtcgtacaaatgctatcttgcttccatac
gttatccgttacaacggtacacgtccagctaagacagcaacatggcctaagtacaactac
taccgtgcagatgaaaaataccaagatatcgcacgcatgcttggacttccagcttctact
ccagaagaaggggttgaatcttacgcaaaagctgtctacgaactcggtgaacgtattggg
atccaaatgaattttagagaccaaggaattgacgaaaaagaatggaaagaacattctcgt
gaattagccttcctggcttatgaagaccaatgttcaccagctaacccacgtcttccaatg
gtagaccatatgcaagaaatcatcgaagatgcatactatggctacaaagaaagaccagga
cgccgtaaataa

DBGET integrated database retrieval system