KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_2210Help
Entry
SPH_2210          CDS       T00658                                 

Definition
alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPH_2210
Enzymes [BR:spv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SPH_2210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2029356..2030414)
Genome map
AA seq 352 aa AA seqDB search
MKAYTYVKPGLASFVDVDKPVIRKPTDAIVRIVKTTICGTDLHIIKGDVPTCQSGTILGH
EGIGIVEEVGEGVSNFKKGDKVLISCVCACGKCYYCKKGIYAHCEDEGGWIFGHLIDGMQ
AEYLRVPHADNTLYHTPEDLSDEALVMLSDILPTGYEIGVLKGKVEPGCSVAIIGSGPVG
LAALLTAQFYSPAKLIMVDLDDNRLETALSFGATHKVNSSDPEKAIKEIYDLTDGRGVDV
AIEAVGIPATFDFCQKIIGVDGTVANCGVHGKPVEFDLDKLWIRNINVTTGLVSTNTTPQ
LLKALESHKIEPEKLVTHYFKLSEIEKAYEVFSKAADHHAIKVIIENDISEA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctatacttatgttaaaccaggacttgcttcttttgttgatgtagacaaacca
gttattcgcaagccaacagacgctattgtgcgtattgtaaaaaccactatttgtggaaca
gacctccatattatcaaaggggatgttcctacttgccaaagtggtaccattcttggccac
gaagggattgggattgttgaagaagttggggaaggagtttccaacttcaaaaaaggtgac
aaggtcttgatttcttgcgtctgtgcctgtggtaaatgctactactgtaaaaaaggaatt
tatgctcactgtgaagacgaagggggctggattttcggtcacttgattgatggtatgcag
gctgaatatctacgtgtccctcatgcagataatactctttaccatactccagaagacttg
tcagatgaagctttggttatgctgtcagacattctgcctactggatatgaaattggtgtc
ttaaaagggaaagtagaacctggttgcagcgtagccattattggttcaggtccagttgga
ttggctgctcttttaacagcccaattctattcaccagctaaattgattatggtagaccta
gacgataaccgcttggaaactgccctatcattcggtgcgactcataaggttaattcttca
gaccctgaaaaagccattaaagaaatttatgatttgacagatggtcgtggtgtggatgtc
gctatcgaagctgttggtattcctgcaacatttgatttctgtcaaaagattatcggtgta
gacggaacggttgccaactgtggtgtgcatggtaaaccagttgaattcgatttagataaa
ctttggattcgcaacatcaatgtaacaactggtttggtatctacaaatacgactccacaa
ttgttgaaagcgcttgaaagtcataagattgaaccagaaaaattggtaactcactatttc
aaactcagtgaaattgaaaaagcctacgaagtcttcagtaaggcagcagaccaccatgcc
attaaggtcattatcgaaaacgatatctcagaagcctaa

DBGET integrated database retrieval system