KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_2296Help
Entry
SPH_2296          CDS       T00658                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPH_2296 (malQ)
Enzymes [BR:spv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SPH_2296 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2103827..2105344)
Genome map
AA seq 505 aa AA seqDB search
MKKRQSGVLMHISSLPGAYGIGSFGQSAYDFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDLDILVEQGLLEASDLEGVDFGSDASEVDYAKIYYARRPLLEKAVKRFF
EVGDVKDFEKFAQDNQSWLELFAEYMAIKEHFENLAWTEWPDADARARKASVLESYREQL
ADKLVYHRVTQYFFFQQWLKLKAYANDNHIEIVGDMPIYVAEDSSDMWANPHLFKTDVNG
KATCIAGCPPDEFSATGQLWGNPIYDWEAMDKDGYKWWIERLRESFKIYDIVRIDHFRGF
ESYWEIPAGSDTAAPGEWVKGPGYKLFAAVKEELGELNIIAEDLGFMTDEVIELRERTGF
PGMKILQFAFNPEDESIDSPHLAPANSVMYTGTHDNNTVLGWYRNEIDDATREYMARYTN
RKEYETVPHAMLRTVFSSVSFMAIATMQDLLELDETARMNFPSTLGGNWSWRMTEEQLTP
AVEEGLLDLTTIYRRINENLVELKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtcaaagtggtgtgttgatgcacatctcttctctcccaggagcttacgga
atcggatcgtttggtcaaagtgcttacgacttcgttgatttcttggttcgtacaaaacaa
cgttactggcaaatccttccattaggaacaactagttacggtgattctccttatcaatct
ttctcagccttcgcaggaaacactcattttatcgatttagatatcttggtggagcaaggt
ttgttggaagccagtgaccttgaaggagttgactttggtagcgatgcgtctgaagttgac
tatgctaagatttactatgcacgtcgtcctcttttagaaaaagcggtgaaacgtttcttt
gaagtcggagatgttaaagattttgagaaatttgctcaagacaaccaatcatggcttgag
ctctttgctgagtatatggctatcaaagagcattttgaaaatcttgcttggactgaatgg
ccagatgcagacgctcgtgctcgtaaagcttcagtacttgaaagctatcgtgagcaattg
gcagacaagttggtttaccaccgtgtgactcaatacttcttcttccaacaatggttaaaa
ttgaaagcatatgctaacgacaatcacatcgaaatcgttggagacatgccaatctacgta
gcggaagattcaagcgatatgtgggcaaatccacatctcttcaagacagatgtcaacggt
aaggctacttgcatcgcaggatgcccaccagatgaattttctgcaactggtcagctttgg
ggtaacccaatctatgactgggaagcaatggataaagacggctataaatggtggattgaa
cgcttgcgtgaaagcttcaaaatctacgacatcgttcgtatcgaccacttccgtggtttc
gaatcttactgggaaatccctgctggttctgatacagcagcacctggtgagtgggtaaaa
ggtccaggatacaagctttttgcagccgttaaggaagaacttggtgagttaaacatcatc
gcagaagaccttggtttcatgacagatgaagttatcgaattgcgtgaacgtactggcttc
ccaggaatgaagattcttcaatttgccttcaacccagaagacgaaagcatcgatagccca
cacttggcacctgctaactcagttatgtacacaggaactcacgataacaatacggtcctt
ggttggtaccgtaacgagatcgatgatgcgactcgtgagtacatggctcgctacacgaac
cgtaaagaatatgaaacagtgccacatgctatgcttcgtacagtcttttcatcagttagc
ttcatggcaattgcaactatgcaagatttgctagaattggatgagacagctcgtatgaac
ttcccatctacccttggtggaaactggtcttggcgtatgactgaagagcaattgacacca
gctgtcgaggaaggtttgcttgacttgacaacaatctatcgccgaatcaatgaaaatttg
gtagaattaaagaaataa

DBGET integrated database retrieval system