KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_2381Help
Entry
SPH_2381          CDS       T00658                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SPH_2381 (glpK)
Enzymes [BR:spv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SPH_2381 (glpK)
Exosome [BR:spv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPH_2381 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2188048..2189556)
Genome map
AA seq 502 aa AA seqDB search
MSQEKYIMAIDQGTTSSRAIIFNKKGEKVSSSQKEFTQIFPQAGWVEHNANEIWNSVQSV
IAGAFIESGVKPNQIEAIGITNQRETTVVWDKKTGLPIYNAIVWQSRQTAPLAEQLKSQG
YVEKFHEKTGLIIDAYFSATKVRWILDHVEGAQERAEKGELLFGTIDTWLVWKLTDGAAH
VTDYSNAARTMLYNIKELKWDDEILEILNIPKAILPEVRSNSEIYGKTAPFHFYGGEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEMQLSENNLLTTIGYGINGKVY
YALEGSIFIAGSAIQWLRDGLRMVENSPESEKYARDSHNNDEVYVVPAFTGLGAPYWNQN
ARGSVFGLTRGTSKEDFIKATLQSIAYQVRDIIDTMQMDTQTAIQVLKVDGGAAMNNFLM
QFQADILGIDIARAKNLETTALGAAFLAGLSVGYWKDLDELKLLNETGELFEPSMNESRK
EQLYKGWKKAVKATQVFAEVDD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaaaatacatcatggccattgaccagggaactacaagttctcgtgccatc
attttcaacaaaaaaggggaaaaggttagctcgagtcaaaaagagtttacccagattttc
cctcaggcaggttgggttgagcacaatgccaatgaaatttggaactctgttcagtcagtt
attgcgggtgctttcatcgaaagtggtgtcaagccaaatcaaatcgaggcaatcgggatt
accaaccaacgtgaaacaacggttgtctgggataagaaaacaggacttcctatctacaat
gctatcgtttggcagtcacgccagacagcacctttggctgagcaactaaaaagccaaggt
tatgtggaaaaattccatgaaaagactggtttgattattgatgcttacttctctgctacc
aaggttcgttggattttggatcatgtagaaggtgctcaagagcgagcagaaaaaggggaa
ttgctctttggtactatcgatacttggttggtttggaaattgactgacggtgcggctcac
gtgactgactactcaaatgcagctcgtaccatgctttataacattaaagaactcaaatgg
gatgatgagattttggaaatccttaacattccgaaggctatacttccagaagttcgttct
aactccgaaatctacggcaagacagctccattccatttctacggtggagaggtgccaatc
tcaggtatggctggggaccaacaagcagccctctttggacagttggcttttgagccaggt
atggttaagaatacttatggaacaggctctttcatcatcatgaatactggggaagagatg
cagttgtctgaaaacaacctcttgacaaccattggttacggaatcaacggtaaggtttat
tatgccttggaaggttctatcttcatcgcaggaagtgctattcagtggcttcgtgacggt
cttcgcatggttgaaaattcaccagaatctgaaaaatacgctcgtgattctcacaacaac
gatgaagtttatgtcgttccagcctttacaggtctaggcgctccatactggaaccaaaat
gctcgtggttccgtctttggtttgactcgtggaacaagcaaagaagactttatcaaggcg
actttgcaatctattgcttatcaagtgcgtgacatcatcgacaccatgcaaatggatact
cagaccgccattcaagtactgaaggtggatggtggtgcagccatgaacaacttcctcatg
cagttccaggcggatattttaggcattgacattgcacgtgctaaaaacttggaaacaaca
gctctaggagcggccttcctagcaggtttgtcagtagggtactggaaagacttggacgag
ttgaaactcttgaacgagacaggagaactctttgagccatctatgaatgaatctcgcaag
gaacaactctacaagggctggaagaaggctgtgaaagcaactcaagtctttgcggaagta
gacgactaa

DBGET integrated database retrieval system