KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0055Help
Entry
SPCG_0055         CDS       T00690                                 

Gene name
purE
Definition
phosphoribosylaminoimidazole carboxylase catalytic subunit
Orthology
K01588  
5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPCG_0055 (purE)
Enzymes [BR:spw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     SPCG_0055 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
57692..58213
Genome map
AA seq 173 aa AA seqDB search
MIVEKEEKGEEMKPVISIIMGSKSDWATMQKTAEVLDRFGVAYEKKVVSAHRTPDLMFKH
AEEARSRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGVDSLYSIVQMPGGV
PVATMAIGEAGATNAALFALRLLSVEDKSIADALTNFAEEQGKIAEESSNELI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtgattgttgaaaaagaggaaaaaggagaagaaatgaaaccagtaatttccatcatcatg
ggctcaaaatccgactgggcaaccatgcaaaaaacagcagaagtcctagaccgcttcggt
gtagcatacgaaaagaaagttgtttccgcacaccgtacaccagacctcatgttcaaacat
gcagaagaagcccgtagtcgtggcatcaagatcatcatcgcaggtgctggtggcgcagcg
catttgccaggcatggtagctgccaaaacaacccttccagtcattggtgtgccagtcaag
tctcgtgctcttagtggagtggattcactctattctatcgttcagatgccgggtggggtg
cctgttgcgaccatggctatcggtgaagctggagcgactaacgcagctctctttgccctc
cgtctcctctctgtagaagataagtccattgcggatgcacttaccaactttgctgaagaa
caaggaaaaatcgcagaggagtcgtcaaatgagctcatctaa

DBGET integrated database retrieval system